SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008494 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008494
Domain Number 1 Region: 20-126,313-618
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.09e-68
Family Integrin alpha N-terminal domain 0.0000415
Further Details:      
 
Domain Number 2 Region: 146-336
Classification Level Classification E-value
Superfamily vWA-like 2.82e-49
Family Integrin A (or I) domain 0.000000389
Further Details:      
 
Domain Number 3 Region: 773-922
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-29
Family Integrin domains 0.0046
Further Details:      
 
Domain Number 4 Region: 618-771
Classification Level Classification E-value
Superfamily Integrin domains 5.75e-28
Family Integrin domains 0.0091
Further Details:      
 
Domain Number 5 Region: 947-1098
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000481
Family Integrin domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008494   Gene: ENSLAFG00000010126   Transcript: ENSLAFT00000010135
Sequence length 1165
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_65:12618532:12642493:1 gene:ENSLAFG00000010126 transcript:ENSLAFT00000010135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVMTRIVVLLLMALPSSLCFNLDTDKPKVFHMDSAGFGHSVVQYDDSWVVVGAPQEIKVA
NQTGGLYQCAYSMEKCEPLPLPVPPEFVNMSLGLSLAATTNPARLLACGPTVYHVCKGNI
YLTGFCFLLTSPSQHVQRLPAALQECPRHEQDILFLIDGSGSITPDDFERMMNFVKAVMS
QFQRPSTQFSLMQFANSFNIHFTFHNFAHSSDPQALLNGVKQLKGLTYTASAIQIATNVM
FSPQKGARENATKILIIITDGQKEGDYLDYKHVIPRAEAAGIIRYAIGVGSAFQKPQSKK
ELKVIASKPSQEYIFQVENFDALRDIQNQLKEKIFAIEGTQSTSTTSFEFEMSQEGFSAV
FTPDGPVLGAVGSFSWSGGAFLYHPNMSRTFINMSQENVSMSDSYLGYSAELAIWKGVQS
LVLGAPRHQHMGKVVIFIQKLMRWILKAEVTGTQIGSYFGASLCSVDVDRDGSTDLVLIG
APHYYQQTRGGQVSVCPLPQGQAKWQCQAVLRGEQGHPWGRFGAALTVLGDVNGDKLTDV
AIGAPGEQENRGAVYVFHGASGVGISPSYSQRITGSQLSLELQYFGQSLSGGQDLTQDGL
VDLAVGARGHALLFRTKPVLQVSVNMHFTPAEIARSVFECRHQVTSAQALGEATVCLHVN
SSFKNQLGNLQSSVTFDLALDPGRLSPRAIFKETKTRNLTQVQDIGLGQHCKAVKLLLLA
CVEDSVTPIILSLNLSLVGKPITSFGDLQPMLAMDAERYFTASLPFEKNCGTDHVCQDDL
GISFSFLGLKTLVVGSNLELNVKVTVWNDGEDSYGTKITFFYPAGLSYRRVTGVQVFQLW
TQLHLSSLRLTCDSAPAESQGPQSTICSINHFIFRDGIQITFVATFDISSKAVLGDQLLL
VANVSSENNSPRSSNTTFQQKLPVKYAVYTVISSHELSTTYVNFSASEEEESSAVKHRYQ
VSNLGQRDLPVRINFRVPMELNQMAVWTGIEVLQPQNLSIQCSSKKIMPTESDFLTHIQK
NPVLDCSIAVCLCFYCDIPSFGIQNQLGFILKGNLSFGWISQTLQKKVFVRSVAEITFDR
TMYSQLPGQEAFMTAQIETVLEKYDVYNPIFLIVGSSVGGLLLLALIVATLYKIGFFKRQ
YKEMMEEANEGTSPQNGISNSLVDQ
Download sequence
Identical sequences G3T519
ENSLAFP00000008494 ENSLAFP00000008494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]