SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008550 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008550
Domain Number 1 Region: 170-299
Classification Level Classification E-value
Superfamily Sec7 domain 1.27e-39
Family Sec7 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 405-518
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-22
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008550   Gene: ENSLAFG00000010206   Transcript: ENSLAFT00000010203
Sequence length 643
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_1:57389170:57411719:1 gene:ENSLAFG00000010206 transcript:ENSLAFT00000010203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGEPDVRDGFSATFEKIVESELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPLIQQR
ARDSPEPGAGLGIGDMEPEGDMGAAGGDGELGSPLRRSISSSRSENVLSHLSLPVMPNGF
HEDGPQGPGGDEDDEEDTDKLLNSASDPSLKDGLSDSDSELSSSEGLEPGSTDPLTNGCQ
GVSEAARRLARRLYHLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRAF
LKAFPLMGETQERERVLTHFSRRYCQCNPEDSTSEDGIHTLTCALMLLNTDLHGHVVGVG
VGHTLSLTHPELSVYPPFASPLPETSYSAVLYSSLPLVQEPPQSPSLLSGRTLSPLQNIG
KKMDASVGRGSSSLAMPLGMHTRVVRDIGVGGRAILPVLPSSAPRGRRGWKKFYAVLKGT
ILYLQKDEYRPDKLSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWRVFLFQAPSK
EEMLSWILRINLVAAIFSAPAFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSHEKKLRQV
TAELAEHRCHPVERSIKSKEAEEYRLKEHYLVFEKSRYETYIYLLAVKIKVGSDDLERIE
ARLATLEGDDPSLRKTHSSPALSQGHGPVTSSKVMKDATGPDT
Download sequence
Identical sequences G3T563
ENSLAFP00000008550 ENSLAFP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]