SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008917 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008917
Domain Number 1 Region: 130-219
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-20
Family Ubiquitin-related 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008917   Gene: ENSLAFG00000010656   Transcript: ENSLAFT00000010655
Sequence length 227
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_10:20609297:20670156:-1 gene:ENSLAFG00000010656 transcript:ENSLAFT00000010655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPA
FEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCL
SPPVNLLLEHTEEESMEPPEPAPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHA
QEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Download sequence
Identical sequences G3T609
ENSLAFP00000008917 XP_003409249.1.64505 ENSLAFP00000008917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]