SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008990 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008990
Domain Number 1 Region: 116-489
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.27e-96
Family Phosphonoacetate hydrolase 0.019
Further Details:      
 
Domain Number 2 Region: 579-823
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.12e-25
Family DNA/RNA non-specific endonuclease 0.012
Further Details:      
 
Domain Number 3 Region: 25-70
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000589
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 71-111
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000102
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008990   Gene: ENSLAFG00000010741   Transcript: ENSLAFT00000010743
Sequence length 837
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:28611745:28658023:-1 gene:ENSLAFG00000010741 transcript:ENSLAFT00000010743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNCRCDVACVGLGNCCLDYQETC
IEPEHIWTCNKFRCGEKRLPRSRCSCSDDCRDKGDCCINYSSVCQGKKSWAEETCESINE
PQCPAGFEMPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKNMRPAYPTKTFPNH
YSIVTGLYPESHGIIDNKMYDPKMNASFALKSKEKFNPEWYKGEPIWLTAKYQGLKSGTF
FWPGSDVQIHGILPDIYKIYNGSVPFEERILAVLKWLQLPKDERPHFYTLYLEEPDSSGH
SYGPVSSEVIKALQRVDNMVGMLMDGLKELDLHRCLNFILISDHGMEQGSCKKYIYLNKY
LGDVKNVKVIYGPAARLRPSDVPDKYYSFNYESVARNLSCREPNQHFKPYLKQFLPKRLH
FAKSNRIEPLTFYLDPQWQLALNPSERKYCGGGFHGSDNLFSNMQAIFIGYGPGFKHGIE
VDPLMCDLLNLTPASNNGTHGSLNHLLKNPVYTPKHPKEVRPLVQCPFTRTSRDNLGCSC
NHSTLPTVDIQTQLNLTAAEEKIIKRGTLPYGRPRVLQKNSTVCLLYQHQFVSGYSHDIL
MPLWTSYTVGRNDSFSTQNFSNCFYQDLRISLSPVHKCSFYKSNTKFSYGFLSPPQLNKG
SRQIYSEALLTSNVVPMYPSFQVIWHYIHGTLLQRYAEERNGVNVVSGPVFDFDYDGLYD
SLETLKKNRKLIRNQEVVIPTHFFIVLTSCENTSQTPLQCENLDTLAFILPHRTDNSESC
VHGKHESLWVEELMKLHRARITDVEHITGLSFYQERKEPVSDVLKLKTHLSTFSQED
Download sequence
Identical sequences G3T665
ENSLAFP00000008990 ENSLAFP00000008990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]