SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000008992 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000008992
Domain Number 1 Region: 93-306
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 291-447
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000702
Further Details:      
 
Domain Number 3 Region: 8-109
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-20
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000008992   Gene: ENSLAFG00000010748   Transcript: ENSLAFT00000010748
Sequence length 513
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_24:39033458:39171769:-1 gene:ENSLAFG00000010748 transcript:ENSLAFT00000010748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFV
RLWVNQEDGVEEVPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHL
KDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGP
CFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTP
VQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQA
SVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYY
KGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFRE
ERKMVQEDEKIGFEISENRKQAAMTVRKVSKQKGVNSARSVPPSYPPPQDPLNQGQYLVP
DGIVQSQVFEFAEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences G3T667
ENSLAFP00000008992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]