SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009144 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009144
Domain Number 1 Region: 719-776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000183
Family Somatomedin B domain 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009144
Domain Number - Region: 64-136
Classification Level Classification E-value
Superfamily E set domains 0.000826
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009144   Gene: ENSLAFG00000010931   Transcript: ENSLAFT00000010933
Sequence length 820
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_68:1003979:1010657:1 gene:ENSLAFG00000010931 transcript:ENSLAFT00000010933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLALLSWALLLLVLSLGLGPQPAAGAQESCAQRCGDKSGPCSCHPTCSGLGSCCSDVRD
FCLDILPYSGSIMGGKDFVVQHLRSGPTDGVVCRFKGSVETHGHVDDSQQVHCVSPLIYE
SGPIPFMLSLDNGRTFERSGTWLAVHPSKVSQTEKCTLVNETRWQYYGTAGAGGNLSVTW
SPGALPTIYVTIELWGYEETGKPYSEEWTAKWSYLYTLAENVSNSGTFTFTPKPAPQNYQ
RWEVGALRILDAAHQAGKRDVRSLWSNEHALAWHLGDDFRADPVAWARTQCLAWEELEDQ
LPDFLGELPECPCTLAQARADSGRFFTDYGCDIEQGSVCTYHPGAVHCVRSVQASPRYAS
GQQCCYTADGTQLLTADSSSGSTPDRGHDWGAPPYLVPPRVPGLSHWLYDVISFYHCCLW
APECHRYMRRRPSSGCRNYQPPRLASAFGDPHFLTFDGTNFTFNGHGEYVLLEAGLTQLS
VQARAQPGMMPNGTQALGTGLTSVVVQEGTSDVLEVRLTDGAKMLQVLLNQHVLSFDEQR
WMDLKGMFLSVATEERVSIMLSSGAGLEVSTQGPSLSVTILLPEKFQNHTRGLLGLNDNP
ADDFTLPSGVLPATASARQLFGFGAEWAVRNESSLFTYDSHFLVNNFLFRPKHDPSFQPL
FPDEVTAYSHLVHEANAFCGEDPFCSFDVVATGSLSVGNATRAAHQLHQRLVQSLQLVVS
CGWVAPPANGHKEGITYLVGSTIRFGCDHGYSLDGAEASTCQADGTWSMPTPRCQPGRSS
TVLLSIIFGGLAVALLVVLLYVLLSWRRKGHRAIAWGPRP
Download sequence
Identical sequences G3T6I8
ENSLAFP00000009144 ENSLAFP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]