SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009221 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009221
Domain Number 1 Region: 373-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-75
Family Protein kinases, catalytic subunit 0.0000000148
Further Details:      
 
Domain Number 2 Region: 7-147
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-40
Family Pleckstrin-homology domain (PH domain) 0.0000475
Further Details:      
 
Domain Number 3 Region: 252-360,388-414
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-28
Family SH2 domain 0.0000984
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009221   Gene: ENSLAFG00000011020   Transcript: ENSLAFT00000011024
Sequence length 655
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_39:16136995:16185399:-1 gene:ENSLAFG00000011020 transcript:ENSLAFT00000011024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDNMDKKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGCIEI
KKIRCVEKVNLAEQTPVERQYPFQIVYKEGLLYIYANEESRSQWLEALQREIRGNPHLLI
KYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHIATKEEKYRPLVFPDRVLKIPRAVP
VLQMDAPSSSTTVAQYDSDSKKSYGSQPNVNMQYVPREDCPDWWQVRKLKSNEDFADSNQ
RERNVVNQSASKISWGVPESSSSEEEENLNDYDWFAGNISRSQSEQLLRQKGKEGAFMVR
NSSQMGMYTVSLFSKAVKDKKGAVKHYHVHTNAENKLYLAENYCFDSIPALIHYHQHNSA
GNSFQIFSYGDSTMPGKVNLCLALLGIWELKREEITLLKELGSGQFGVVQLGKWKGKYDI
AVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKRYPIYIVTEYITNGCLLNYLK
SHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRYVL
DDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVV
VKVSQGYRLYRPQLASDTVYQIMYSCWHEASLPEKRPTFQQLLSSIEPLREKDKP
Download sequence
Identical sequences G3T6P7
ENSLAFP00000009221 ENSLAFP00000009221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]