SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009381 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009381
Domain Number 1 Region: 834-1069
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-55
Family DBL homology domain (DH-domain) 0.0000353
Further Details:      
 
Domain Number 2 Region: 1067-1195
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-34
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 650-702
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000143
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 
Domain Number 4 Region: 135-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000571
Family Ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009381   Gene: ENSLAFG00000011204   Transcript: ENSLAFT00000011213
Sequence length 1654
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_7:76407924:76613375:1 gene:ENSLAFG00000011204 transcript:ENSLAFT00000011213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEINLSNDIKQGQMTVYAKFGKNVYLPKDAEFYFIYNGSHQRHITIAERIADNVLQSSIP
GHRLQETVMVSICLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQADRLTTCSHRTLLT
PFALTAEALPALDEELVLAMTHLELPLGWTILGNSSLEVSPHRESLLHLATRWGLAKLSQ
FLLCLPGGVQALALPNEDGATPLDLALHAGHSKLVENITNFQGRHSAGFSRLQLSEDAFL
QYAHSSGTLTLTFNHTAECLLEADIKLFRKYFWDKAFLFKALDEKGAKPEERPTMPSSTA
ETEEEIKNLVSRGSSPEEEDVKCVKIPEAQLNEHEDQGSLDLDRSFDMFKKSKHLPTFLA
AGRLSDMLNGGDEVYANCMVIDQVGDLDINYINIEGITANPNPEPMGSTLGSQRCKNILP
SEASPDMHPLSENSEVTSNVEAQQHFISPSSSCASNLSLSFGLHGLEKEQSHLKKRSSSL
DALDADSEGEGHTERAHICYTPVSQSSSRTGIPSGDEMDSFESNTEPDFNISRAESLSFS
SNLQSKESLISGVRSRSYSCSSPKISFGKSRVVRDFTVCNSSEEQRDYSVLEPPGEKRIQ
EEEWDRYIMPAKLESEKYKVSRTFSFLMNRINSPRNKSKKMKSKDAKDKEKLSRHQFVPG
TFSGVLQCLVCDKTLLGKESFQCSNCSAHIHKSCKDAAPPCTKKFQEKYNKHKPQTVLGN
SSFRDLQQPGLSLHPSSSMPIGLPTGRKETAGQVHPLSRSVPGTTLESFRRSGTSLESES
DSSNWRSRSHSDELIQSMGSSPSTESFIMEDTLDVVDSSLWSDLSSDAQEFEAESWSLVV
DPSFCSRQEKDVIKRQDVIFELMQTEMHHVQTLFIMSEIFRKGMKEELQLDHSTVDKIFP
CLDELLEIHRHFFYCMKERRQESCVDNDRNFVISRIGDILVQQFSEENANKMKKIYGEFC
SHHKEAVSLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQ
YTKERTEEHKDLCKALCFIKDMIAAVDLKVSEYEKNQKWLDILNKIENKTCTKLKNGHVF
RKQALISKERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSV
ISLQKLIAREVANEERGMFLISASSSGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEEG
GRTGESDEERRKAEARVAKIQQCQEILSNQDQQICTYLEEKLQIYAELGELSGFEDVHLE
PHLLIKPDPGEPPQAASLLAAAMKEAESLQVAVKASQMGDVSQSLEESRVESGLTDMLSS
SDEPGSPDSSVVTEGTGGRGCWDVDPGTQGVVTDLAVSDAGEKVEYRNFPSSSQSEMIQA
IQNLTRLLYSLQAALTIQDSHIEIHKLVLQQQERLSLGHSFRGSPFQDQDKDRNLEKQRE
ELANIHKLQHQFQQDQRRWHRRCDQQQREQEAKESWLQERERECQSQEELLLRNRGELAH
QLQEYQQNLERLREGQRMVEREREKMRTQQRLLCRWKHGRQSSLPAAFSPGSKEVMDLNR
SESFCHENSFFINEALVQMSLNTFNKPNLSDTHQDDIDPPNISHSDLVRTSENQVDLKMD
VSQPLDINHELWTAPGSCHQIPPLHKSSKDSCKN
Download sequence
Identical sequences G3T729
ENSLAFP00000009381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]