SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009383 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009383
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-56
Family DBL homology domain (DH-domain) 0.0000328
Further Details:      
 
Domain Number 2 Region: 452-573
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-31
Family Pleckstrin-homology domain (PH domain) 0.00051
Further Details:      
 
Domain Number 3 Region: 29-91
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009383   Gene: ENSLAFG00000011210   Transcript: ENSLAFT00000011215
Sequence length 988
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:4458851:4482004:-1 gene:ENSLAFG00000011210 transcript:ENSLAFT00000011215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRIESLTRARIERSKELASKTREKERMREAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKSNAALQSVSLRCKTTTRERP
TSAIYPSDSFRQSLLGSRRGRSALSLSKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEGAEVIYNELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRVGMLEELQLELGVVQGLFPCVDELTEIHTRFLSQLLE
RRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRSAVMKRHGVQECILLVTQRITKYPVLISRILQHSHGNEEEHQDLTMAL
GLVKELLSNVDQDVHELEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLLHDGCL
LWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQQLIVRDIANQEKGMF
LISSGRPPEMYEVHTASRDDRSTWIRVIQQSVRVCPSRENFPLIETEDEAYLRRIKLELQ
QKDRALVELLKEKVGLFAEMTHFQAEEDGSSGMPLPALPRGLFRSESLESPRGERLLQDA
IREVEGLKDLLVGPGVELLSTPREPALPVEPDSSGNTSPGVTANGEARTFNGSIELCRAD
SDSSQKDRNGNQLRSPQEEVLQRLVSLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLS
RANSRDGEAGRAGTAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEASSLEAR
LWESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRALDPRRRSLPAGDALYLSFT
PPQPSRGHDRLDLPVTIRSIHRPFEDRERQELGSPEEQLQDSSDPDTGSEEEGSSRLSPP
HSPRDFTRMQDIPEETESRDGEPIASES
Download sequence
Identical sequences G3T731
ENSLAFP00000009383 ENSLAFP00000009383 XP_003415185.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]