SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009387 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009387
Domain Number 1 Region: 9-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-20
Family Ubiquitin-related 0.00013
Further Details:      
 
Domain Number 2 Region: 547-597
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000657
Family UBA domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009387
Domain Number - Region: 217-266
Classification Level Classification E-value
Superfamily ARM repeat 0.00518
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009387   Gene: ENSLAFG00000011221   Transcript: ENSLAFT00000011222
Sequence length 601
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_33:4550835:4568595:-1 gene:ENSLAFG00000011221 transcript:ENSLAFT00000011222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGSVGGARAEPAIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKI
LKDGDTLNQHGIKDGLTVHLVIKTPQKVQDPAATTASSPSTPDPASAPSTMPASPATPAQ
PSTSGSTTSDAGSGSRRSSGGGPSPGAGEGPPSATASILSGFGGILGLGSLGLGSANFME
LQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQLMERNPEISHMLN
NPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMFSAAREQ
FGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGTGGSGTSQVHP
TVSNPFGINAASLGSGVFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQ
TEAPGLVPSLGSFGMSRTPAPSAGSNTGPVPEAPSSSPATPATSSPTGTSSAQQQLMQQM
IQLLAGSGNSQVQTPEVRFQQQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQL
S
Download sequence
Identical sequences G3T735
ENSLAFP00000009387 ENSLAFP00000009387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]