SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009539 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009539
Domain Number 1 Region: 45-241
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 8.76e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.000011
Further Details:      
 
Domain Number 2 Region: 323-475
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 4.58e-63
Family C-terminal domain of adenylylcyclase associated protein 0.000000348
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000009539
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000199
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009539   Gene: ENSLAFG00000011419   Transcript: ENSLAFT00000011421
Sequence length 477
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_44:10706821:10857355:-1 gene:ENSLAFG00000011419 transcript:ENSLAFT00000011421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMQGLMQRLEQAVVRLELLSAGSHRPPGDCGEVNGVNGGVTPSVEAFDKLMNGMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRAFLLMASQYQQPQEHDVAALLKPISEKIQEIQTF
RERNRGSSMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLR
HVDWVKSYLNIWNELQAYIKEHHTTGLTWSKTGPVASTASVLSAFSPGPGLPPPPPPPPP
PGPPPLFDNEGRKEESSPSRSALFAQLNQGEAITKGLRHVTDDQMTHKNPSLRAQGGQTR
SPTKSLTPSPTSPKSHPPQKHVPVFELEGKKWRVEYQEDRNDLMVADTQLKQVAYIFKCN
KSTLQMKGKINSITIDNCKKFGLVFDNVVGIVEVINSKDIQIQVMGRVPTISINKTEGCH
IYLSEDALDCEIVSAKSSEMNILIPQDGDYREFPVPEQFKTIWDGSKLITEPAEIMA
Download sequence
Identical sequences G3T7F7
ENSLAFP00000009539 XP_003416506.1.64505 XP_010594497.1.64505 ENSLAFP00000028633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]