SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009805 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009805
Domain Number 1 Region: 312-649
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 5.86e-130
Family Mammalian PLC 0.0000000000288
Further Details:      
 
Domain Number 2 Region: 145-311
Classification Level Classification E-value
Superfamily EF-hand 6.06e-49
Family EF-hand modules in multidomain proteins 0.0000000566
Further Details:      
 
Domain Number 3 Region: 11-141
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-43
Family Pleckstrin-homology domain (PH domain) 0.000000179
Further Details:      
 
Domain Number 4 Region: 994-1127
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.22e-34
Family C-terminal domain of PLC-beta 0.000013
Further Details:      
 
Domain Number 5 Region: 669-786
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.61e-24
Family PLC-like (P variant) 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009805   Gene: ENSLAFG00000011725   Transcript: ENSLAFT00000011733
Sequence length 1161
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_64:9893151:9913307:-1 gene:ENSLAFG00000011725 transcript:ENSLAFT00000011733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLNPVLLPPEVKTYLSQGERFIKWDDETTIASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKIPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKDWAEDVLALVKHPLTTNAPRSAFLDKILVKLQMQLNSEGKIPVKNFFQLFPADRKR
VEAALSACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPAQPDQVQGLIDKYEPSGINVQRGQLSPEGMVWFLSGPEN
SVLAQDKLLLYQDMTQPLNHYFINSSHNTYLTGSQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRTMFGDMLLTEPLEKFPLKPGTPLPSPEDLRGKILIKNKKNQFSGPISLSKEPGEA
EGSCPPKVLVGEDTVWTGEEGAESGSLDEEEIKKMQSDEGTAGLEVTAYEEMSSLVNYIQ
PTKFISFEFSSQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQMSRIYPKGTRVDSSN
YMPQMFWNSGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMRRPDKQFNPFSVD
RIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRTKLSPSPNSINPVWK
EEPFVFEKIMIPELASLRVAVMEENNKFLGHRIIPINALNSGYHHLCLHSESNMPLTMPA
LFVFLEMKDYVPDTWAVLPWTLTNPIKFFSAHDKKSVKLKEAMGGGLPENPFPPRSSVAG
QVNGTSAPTSNGSAGPPTHWEASVVVLVFTHRHIPAWQRLFKKKTFTWEGRAGLCLKSRG
WIGAVQGAHTSTPRGGELSQPILWLLQRPGLGRRPRKKKPQVRPAEPRGLGDGPRAGLGL
LRAVGRKERLPGRRRAHTCSIEPQTASLEELRELKGVVXEQAAELKALKETSENDSREMK
KKLEAKRLERIQAMIKVTTDKMAQERLKREINSSHIQEVVQVIRQMTETLERHQEKLREM
QAACLERIRELEKQFQQEALAEYEARMKGLEAEVKESVRACLRTCFPSEAEDRSERPCGA
TMEPSEEDPLTAGADTQECRL
Download sequence
Identical sequences G3T825
ENSLAFP00000009805 ENSLAFP00000009805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]