SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009901 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009901
Domain Number 1 Region: 374-564
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.51e-56
Family Nuclear receptor ligand-binding domain 0.0000265
Further Details:      
 
Domain Number 2 Region: 94-184
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009901   Gene: ENSLAFG00000011851   Transcript: ENSLAFT00000011849
Sequence length 567
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_36:15587033:15609902:-1 gene:ENSLAFG00000011851 transcript:ENSLAFT00000011849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSVIAYISSSSSASSPASCHSDGSENSFQSSSSVPSSPNNSNTDHNGNPKNGDLSNIEGI
LKSDRIDGSMKTSKSSVPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGF
FRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQR
MLIEMQSAMKTMMNSQFSGHLQNDMLVEHHEQTALPAQEQLRPKPQLEQDHIKSSSPSSD
FAKEEVIGLVTRAHKDTFMYNQEQRENSAETVHPQRGERIPKNLEQYNLNHDRCGSGFSS
HFPCSESQQHLNGQYKGRNIMHYPNKHGICLANGHCMNFSNAYPQRVCDRVPVDGFSQNE
NKNSYVCNTGGRVHLVCPMSKSPYVGPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFR
DLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDALHSMGAGDLLNSMF
EFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVHSGALQETLIRALRTLIMKNHPNES
IFTKLLLKPDLRSLNMHSEELLFKVHP
Download sequence
Identical sequences G3T8A3
ENSLAFP00000009901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]