SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009948 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009948
Domain Number 1 Region: 564-772
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-48
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 2 Region: 70-148
Classification Level Classification E-value
Superfamily F-box domain 4.32e-19
Family F-box domain 0.00085
Further Details:      
 
Domain Number 3 Region: 794-903
Classification Level Classification E-value
Superfamily PH domain-like 5.11e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009948   Gene: ENSLAFG00000011906   Transcript: ENSLAFT00000011906
Sequence length 905
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:20706467:20775469:-1 gene:ENSLAFG00000011906 transcript:ENSLAFT00000011906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRREFLFTIFLRCTKSQLR
FVQDCFSQRMQVAKVDFSTVLPRFISLYIFSFLNPKDLCAAAQVSWSWKFLTEQDCLWRP
KCIKFGWFLPYTPTDNEYGAWKHHYIACVSNLDWLTPRESTAVYGTLNEPKVGDEELQER
QREKCLRKLIWEKIGLRKKELFKARPPWVSGTCCSRLLKSKCQPRLSQTVRDRVGLHEAL
EKQLVLASLEALPKRSNVSGSHSYPSLSKKNWRGVFKNYDCSSNAFQLHCILISSRIPAY
EMVVDSVKVDVISVVYEHCGITLEGLLSLIEKALDGRKAQSMGIFSDGDSREINLLQGYK
IGIKNLLRPEVRDFWEKLGSYVATEEEGGHVDLFVPLAASEAGVEVLSQLSQLTGTLFTA
PTGIATGSYQHILSDWLGQQWEKAPPSIYFIESKLQTWSSLMDFLEDTLKSVRRQFSPFS
KELKKNISGRVIGQLMFDMMSTINILNSQEIAQALADGLMELSKENSEGNDVEDNSKDTK
SSLRKNDLNFEVLVKLERKLQMDSAEKRTRVVRELLLSERKYVQMLEIVRDVYVTPMKAA
LSSNRAILSAANIQIIFSDILRILSLNRQFLDNLRDRLQEWGPAHCVGEIFLKFGSQLNT
YTNFFNNYPVVLKTIEKCREMIPAFRAFLKRHDKTIITKMLSLPELLLYPSRRFEEYIHL
LYALRLHTPAEHIDREDLTTAIDQIKQYKGYIDQVKQNINQKDQLSDIQRTIWGCPTLSE
VNRYLIRVQDVAQLHCSDEEIIFSLRRYEHIHDLSLFLFNDALLVSSRGTSHTPFERTSK
TTYRFIASVALHRLLVGDIPDSKYTKNAFILQGPKHGWICATEAEEDKFLWLSVLQNAIK
SSVEK
Download sequence
Identical sequences G3T8E0
ENSLAFP00000009948 ENSLAFP00000009948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]