SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000009989 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000009989
Domain Number 1 Region: 1379-1430,1476-1656
Classification Level Classification E-value
Superfamily VPS9 domain 8.11e-42
Family VPS9 domain 0.0019
Further Details:      
 
Domain Number 2 Region: 12-218
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 9.16e-40
Family Regulator of chromosome condensation RCC1 0.0049
Further Details:      
 
Domain Number 3 Region: 522-687
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.92e-27
Family beta-lactamase inhibitor protein-II, BLIP-II 0.066
Further Details:      
 
Domain Number 4 Region: 1048-1137
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 3.01e-22
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.01
Further Details:      
 
Domain Number 5 Region: 1142-1250
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 2.48e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.024
Further Details:      
 
Domain Number 6 Region: 928-1014
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000252
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 693-892
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000000000102
Family DBL homology domain (DH-domain) 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000009989   Gene: ENSLAFG00000011953   Transcript: ENSLAFT00000011953
Sequence length 1658
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:24927028:24983955:1 gene:ENSLAFG00000011953 transcript:ENSLAFT00000011953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKKRSSAEAEGSKERGLVHVWQAGSCSVTPERLPGWGGKTVLQAALGMKHGILLTEDG
EVYSFGTLPWRRDPAEVSPSSPVLENALAGQYVVTVATGSFHSGAVTESGTVYMWGENSA
GQCAVANQQYVAEPNPVSISDSETSPLLAVRILQLACGEEHTLALSISREIWAWGTGCQL
GLITTTFPVTRPQKVEHLAGRVVLQVACGAFHSLALVQCLPSQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVMLSESQAENHASTAITPSTLETFDSQVEVFENTQTENDL
PAATELNVGNVQTTSDGASSSQQGIMGTTEVSSARNIPSYPDTQTITEYLQKLSDHSIRE
DAENGAKPVPCQPLVEEAIPNLHSLPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLK
KVMNFYSTAPCETGAQAGSSSVGPEGLKDSREEQVKQESMQGKKSSSLVDIREEESEGGS
RRLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQL
GHGDVLPRLQPLCVKFLDGKEVIYLEAGGYHSLALTAKSQVYSWGSNTFGQLGHSDFPTT
VPRLAKVNGENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDPAEGDSLPDDQSGTKTP
VLLSGSKLGYISRVTAGKDSFLTLADKNIMGYIASLHELATTERRFYSKLSDIKSQILRP
LLTLENLGSATTVQLLQEVASRFSKLCYLIGQHGTSLSSFLHGIKEARSLVILKHASLFL
DSYTEYCTSITNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEMNDENTQLMEILNTLFFL
PIRRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYESLALHLGRKRKEAEYTLGFWKTF
PGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATL
WVEPLSEEAGGVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGTSDLPPYGS
GSNIQRQEPPISRSAKYTFYKDPRLKDATYNGRWLSGKPHGRGVLKWPDGKMYSGMFRNG
LEDGYGEYRILNKALNKEDHYVGHWKEGKMCGQGIYSYASGEVFEGCFQDNMRHGHGLLR
SGKLTSSSPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYE
GNFNLNKMMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPNGDYIEGFFSGEWGSGIKI
TGTYFKPSLYESDKDRPKVFRKLGNLAVSADEKWKAVFDECWRQLGCESPGQGEVWKAWD
NIAVALTTSRRQHRDSPEILSRSQTQTLESLEFIPHHVGAFSVEKYDDIKKYLIKACDTP
LHPLGRLVETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGST
IPLSAPLPTERKSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDR
EEDIYWECVLRLNKQPDIALLGFLGVQRKFWPVTLSTLGESKKVLPTTKDACFASAIECL
QQISTTFTPSDKLKVIQQTFEEISQSVLATLQEDFLWSMDDLFPVFLYVVLRARIRNLGS
EVHLIEDLMDPYLQHGEQGIMFTTLKACYYQIQREKLN
Download sequence
Identical sequences G3T8H3
ENSLAFP00000009989 ENSLAFP00000009989 XP_003406182.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]