SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010093 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010093
Domain Number 1 Region: 42-240
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 9-45
Classification Level Classification E-value
Superfamily PH domain-like 0.00000177
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000010093
Domain Number - Region: 550-647
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000518
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010093   Gene: ENSLAFG00000012071   Transcript: ENSLAFT00000012075
Sequence length 660
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_30:9688317:9767639:-1 gene:ENSLAFG00000012071 transcript:ENSLAFT00000012075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGN
RLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVAS
LLKLYLRELPEPVIPYAKYEDFLSCAKLLSKDEEAGVKELAKQVKSLPMVNYNLLKYICR
FLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSMMISKHDRLF
PKDAELQSKPQDGVSNNNNEIQKKATMGQLQNKENNNSKDSPGRQCSWDKSESPQKSGVD
NGSPTTLSGSKTNSPRNSIHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSSAEGLEK
SQTTPNGTLQARRTSSLKGPGTKMGTHSVQNGTVRMGILNTDTLGNPTNGRSMSWLPNGY
VTLRDNKQKEQAGESGQHNRLSTYDNVHQQFSMMNLDDKQSVDSATWSTSSCEISLPENS
NSCRSSTTTCPEQDFYSGNFEDPVLDGAPQDDLSHTGDYENKSDRRSVGGRSSRATSSSD
NSETFVGNNTSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELD
QERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRSERGNTIWIQ
Download sequence
Identical sequences G3T8R2
ENSLAFP00000010093 ENSLAFP00000010093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]