SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010170 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010170
Domain Number 1 Region: 344-534
Classification Level Classification E-value
Superfamily Sec7 domain 1.57e-65
Family Sec7 domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 542-674
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000642
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010170   Gene: ENSLAFG00000012165   Transcript: ENSLAFT00000012167
Sequence length 879
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_15:46695527:46737603:-1 gene:ENSLAFG00000012165 transcript:ENSLAFT00000012167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIEMLEHKYGGHLVSRRAACTIQTAFRQYQLSKNFEKIRNSLLESRLPRRISLRKVRAPT
AESLAAEKALMEGYGLMGLPLVRSPSLPPTFAGTLTELEDSFTEQVRSLAKSIDDALSTW
SLKTMCSLQESGAYQIHQALHTAAAPPGLEAELGEPEGAGPGPGNEAAETAGLPQGHSST
LMMAFRDVTVQIANQNISVSSSTALSVANCVGAQTTQATSEPAASRAEQGQAGGQESPAV
PAAGQGDAPSENPCVEAETSVAASSNGLGTAEAVTKETVTEAEAGDNLEQMSSSSTSTKS
AKSGSEVSASASKEALQAMILSLPRYHCENPASCKSPTLSTDTLRKRLYRIGLNLFNINP
DKGIQFLISRGFIPDTPIGVAHFLLQRKGLSRQMIGEFLGNSKKQFNRDVLDCVVDEMDF
SSMELDEALRKFQAHIRVQGEAQKVERLIEAFSQRYCMCNPEMVQQFHNPDTIFILAFAI
ILLNTDMYSPNIKPDRKMMLEDFIRNLRGVDDGADIPRELVVGIYERIQQKELKSNEDHV
TYVTKVEKSIVGMKTVLSVPHRRLVCCSRLFEVTDVNKLQKQAAHQREVFLFNDLLVILK
LCPKKKSSSTYTFCKSVGLLGMQFHLFENEYYSHGITLVSPLSGTEKKQVLHFCALGSDE
MQKFVEDLKESIAEVTELEQIRIEWELEKQQGAKTLSFKSSGAQADPQSKQGSPTVKAKR
DSALGEKPAESTVEVSIHNRLQTSQHNPGLGAEKGAPAPLPNLQPSPLREQPPLLPPPPP
PTPPGTLVQCQQIVKVIVLDKPCLARMEPLLSQALSCYASSSSDSCGSTPLGGRGSPVKV
IHQPPLPPPPPPYNHPHQYCPPGSLLHRRRSSSGSRSLV
Download sequence
Identical sequences G3T8W9
ENSLAFP00000010170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]