SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000010589 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000010589
Domain Number 1 Region: 618-686,919-1255
Classification Level Classification E-value
Superfamily Ras GEF 2.75e-120
Family Ras GEF 0.00001
Further Details:      
 
Domain Number 2 Region: 223-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 24-155
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-19
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 4 Region: 433-587
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000616
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000010589   Gene: ENSLAFG00000012659   Transcript: ENSLAFT00000012664
Sequence length 1258
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_28:10076649:10190342:-1 gene:ENSLAFG00000012659 transcript:ENSLAFT00000012664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHHYFTVNFSHENQKALELRTEDAKDCDE
WVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIA
SLLKDNERIQSTQTVTPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMR
KRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFL
HQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKL
LKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEEL
SRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRL
GSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEDPETTEEEAKGS
GQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEEN
SKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLN
TFLHSYRVFTTAVVVLDKLITIYKKPISAIPARSLELLFASGQNNKLLYGDPPKSPRATR
KFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKA
TLDTSKLYVSSSFANKIPDESDTTTEKTEDPSALSKQSSEVSVREESDIDQNQSDDGDTE
TSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDSNRSALSAASAFAIATAGANE
GTPNKEKYRRMSLASTGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDEL
KCKVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFE
NHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIAS
EIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQT
KALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNF
SKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT
Download sequence
Identical sequences G3T9U5
ENSLAFP00000010589 ENSLAFP00000010589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]