SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011144 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011144
Domain Number 1 Region: 338-592
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-65
Family Nuclear receptor ligand-binding domain 0.0000000011
Further Details:      
 
Domain Number 2 Region: 266-343
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-28
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011144   Gene: ENSLAFG00000013317   Transcript: ENSLAFT00000013316
Sequence length 597
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:38405938:38410894:1 gene:ENSLAFG00000013317 transcript:ENSLAFT00000013316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCIQAQYGTTAPSAGAHDHLASDPLTPELSKSTMDLASPEAAPAAPTALPSFSTFMDGY
TGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASTAFKFEDFQVYGCYPGTLSGPL
DETLSSSGSDYYGSPCSVPSPSTPSFQPPQLSPWDGSFGHFSTSQTYEGLRAWTEQLPKA
SGPPQPPAFFSFSTHTGPSPSLAQSPLKLFPSQATHQLREGESYSMPAAFPGLAPTSPHL
DGSGILDVPVTSAKARSGAPSGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAK
YICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDAS
PANLLTSLVRAHLDSGPSTTKLDYSKFQELMLPRFGKEDAGDVQQFYDLLSGSLEVIRKW
AEKIPGFTELSPGDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCARGFG
DWIDSILAFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVS
AVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIVDTLSF
Download sequence
Identical sequences G3TB33
ENSLAFP00000011144 ENSLAFP00000011144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]