SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011346 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011346
Domain Number 1 Region: 196-377
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.27e-50
Family DBL homology domain (DH-domain) 0.0000119
Further Details:      
 
Domain Number 2 Region: 385-511
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-30
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011346   Gene: ENSLAFG00000013560   Transcript: ENSLAFT00000013558
Sequence length 619
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:46901562:46908567:1 gene:ENSLAFG00000013560 transcript:ENSLAFT00000013558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPDRPASGRTDRILGVMGGMLRACALPGQEGPPKRSPLGPGGTEPESDRTEGDQREER
EREAPDWALQPESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPGPPGPISGLRRW
LDHSKHCLSVETEMDGGQAGPYENWMLEPALATGEELPGLTLLTTLLESPRDKTQPAEEE
TASQASESEEEQKKAALERSMYVLSELVETEKMYVEDLGQIVEGYMATMAAQGVPENLRG
RDRIVFGNIQQIYEWHRDYFLQELQKCLEDPDWLAQLFIKHERRLHMYVVYCQNKPKSEH
VVSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSRAGMDTEELER
AVEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSRGRERRV
FLFEQIIIFSEALGGGVRGGTQPGYVYKSSIKVSCLGLEGNLQGDSCRFALTSRGPEGGI
QRYVLQATDPAVSQAWIKQVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGS
LGRPRPGDRAQVSTYTPINGSLPSLLLLPKGEVARAPLPLDTQTPSDIPQAPRDSPPVPP
ILNTPPCQARLAKLDEDEL
Download sequence
Identical sequences G3TBI9
ENSLAFP00000011346 XP_003405207.1.64505 ENSLAFP00000011346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]