SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011363 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011363
Domain Number 1 Region: 86-413,443-555
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-121
Family Ras GEF 0.0000487
Further Details:      
 
Domain Number 2 Region: 674-768
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.15e-40
Family Ras-binding domain, RBD 0.00000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011363   Gene: ENSLAFG00000013578   Transcript: ENSLAFT00000013578
Sequence length 803
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_16:16361475:16566470:-1 gene:ENSLAFG00000013578 transcript:ENSLAFT00000013578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKTVGEPSQVVSKFKLPTKVDSTGHWLVEDHARIWEVLKTEESSIQDWGEEVEEGAVY
HVTLKRVQIQQAANKGARWLGVEGDQLPPGHTVSQYETCKIRTIKAGTLEKLVENLLTAF
GDNDFTYISIFLSTYRGFASTKEVLELLLDRYGNLTSPNCEDDGNQTSSESKMVIRNAIA
SILRAWLDQCAEDFREPPHFPCLQKLLDYLKRMMPGSDPERRAQNLLEQFQKQEVETDNG
LLNTISFSLEEEEEPEGGGPAEFTFFSEDLVAEQLTYMDAQLFKKVVPHHCLGCIWSQRD
KKENKHLAPTIRATISQFNTLTKCVVSTILGGKELKTQQRAKIIEKWINIAHECRILKNF
SSLRAIVSALQSNSIYRLKKTWAAVPKDRMLMFEELSHIFSDHNNHLTSRELLMKEGTSK
FANLDSSVKENQKRTQRRLQLQKDMGVMQGTVPYLGTFLTDLTMLDTALQDYIEGGLINF
EKRRREFEVIAQIKLLQSACNSYCMTPDLKFIQWFQRQQLLTEEESYALSCEVEAAADTS
ATSPKPRKSMVKRLSLLFLGSDIITNSTPTKEQPKSTASGSSGESMDSVSVSSCESNHSE
AEEGSITPMDTPDEPPKKLSESSSSCSSIHSMDTTSSGMSSLVNPLSSPPSCNNNSKTHK
RSVSVTSITSTVLPPVYNQQNEDTCIIRISIEDNNGNMYKSIMLTSQDKTPAVIQRAMLK
HNLDSDPAEEYELVQVISEDKELVIPDSANVFYAMNSQVNFDFILRKKSPMEEQVKLRSR
TSLTLPRTAKRGCWSNRHSKVTL
Download sequence
Identical sequences G3TBK3
ENSLAFP00000011363 ENSLAFP00000011363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]