SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011383 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011383
Domain Number 1 Region: 25-144,326-614
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.11e-48
Family Integrin alpha N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 110-331
Classification Level Classification E-value
Superfamily vWA-like 3.48e-42
Family Integrin A (or I) domain 0.000000104
Further Details:      
 
Domain Number 3 Region: 773-912
Classification Level Classification E-value
Superfamily Integrin domains 3.24e-25
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 4 Region: 614-772
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-20
Family Integrin domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011383   Gene: ENSLAFG00000013591   Transcript: ENSLAFT00000013602
Sequence length 1162
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_65:11650130:11692858:1 gene:ENSLAFG00000013591 transcript:ENSLAFT00000013602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSCITLMRLLLSGPFLFAPASSYNLDVLHAQNFSSQDAGRHFGYRVLQVGNGVVVGAP
GEGNNVGNLYQCQPDTGHCLPVSLSGSNYTSKYLGMTLATDPISGSLLACDPGLSRACDQ
NIYLSGQCYLFHQNLGSPVHQGRPGYQECIKGNVDLVFLFDGSRSMQPDEFQKIVDFMKD
VMKKLSNTSYQFAAVQFSTTYKTEFNFLDYVGQKDPDTLLAKVKHMAQLTNTFGAINYVA
TKVFQQKLGARPDATKVLIIITDGEATDKGSIDVAKDIIRYIIGIGKHFQKQESQETLHE
FASKPTKEFVKILDTFEKLKGLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLNHN
RGVVGAVGAKDWTGGFLDLKADLQEDIFVGKEPLTQEARTGYLGYTVTWLPSRRHTSLLA
AGAPRYQHTXIQALSSASSAQEHPTPPGAPAQGSQIGSYFGGELCGIDMDQDGETELLLI
GAPLFYGEQRGGRVFVYHRKQVGFEEVSELQGDPGYPLGRFGAAITALTDINGDRLMDVA
VGAPLEDQGALYIFNGRRGGLSSRPSQRIKGNQVFSGIRWFGRSIHGVKDLGGDGLTDVA
VGAEGQVIILSSRPVVDIITRMAFSPAEIPVHEVDCSYSASNRKKEGVNITICFQVKPLL
PQFQRPLVANLTYTLQLDGHRTRSRGLFPGGKHELSGNTAVTSRESCSEFWFHFPVCIQD
LISPVNVSLNFSLWEEEGTPRDHRVGKDVQPILRPIPHSETKEIPFEKNCGEDKKCEANL
ELFPSERSTVLRLISSASLSVELTLSNVAEDAYWVHLGLSYPQGLSFRKVEMLKPHSQMP
VSCEELPKESRLLTSALSCNVSSPIFKAGSSVVIQVMFHTLLNSSWGDFVELQANVSCDN
EDSGLLDNNMAITRIPVLYPINILIEDQGNSTLYINFKPKGPKIQHVKHIYQVRITPSIH
DHDLPALEALVAVPQCHSKGPLTCNWSVEMEPPVTCHPEVLKRLPSAAEPCLPGAEFRCP
VVFKEESLIQVNGIVELTGEIEGPSMFSLCSSLYISFNSSKHFHLYGSNASLAQVVMKVD
VVYEKEMLQVYALSGIGGLLLLLLIFVVLYKIGFFKRNLKEKMEADAGARNGIPGEGSEK
PESGEEAADVGCLEPLQGEEGQ
Download sequence
Identical sequences G3TBM1
ENSLAFP00000011383 ENSLAFP00000011383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]