SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011504 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011504
Domain Number 1 Region: 17-123,312-616
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.15e-66
Family Integrin alpha N-terminal domain 0.0000748
Further Details:      
 
Domain Number 2 Region: 105-334
Classification Level Classification E-value
Superfamily vWA-like 1.4e-50
Family Integrin A (or I) domain 0.000000151
Further Details:      
 
Domain Number 3 Region: 773-919
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-34
Family Integrin domains 0.0032
Further Details:      
 
Domain Number 4 Region: 616-772
Classification Level Classification E-value
Superfamily Integrin domains 2.01e-31
Family Integrin domains 0.0046
Further Details:      
 
Domain Number 5 Region: 950-1094
Classification Level Classification E-value
Superfamily Integrin domains 0.000000000575
Family Integrin domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011504   Gene: ENSLAFG00000013737   Transcript: ENSLAFT00000013742
Sequence length 1152
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_65:12549298:12583634:1 gene:ENSLAFG00000013737 transcript:ENSLAFT00000013742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTKFFLLTGLALCHGFNLDTENAMIFQENARGFGQSVVQFEGSRVVVGAPQEVKAPNQT
GSLYQCDYSVGRCEPIPLQVPLQAVNMSLGLSLAATTTPSRLLACGPTVHQICKENTYVN
GFCFMFGSNLLQQPRRFPETLRECPRQESDIVFLIDGSGSISLSDFQRMKEFVSTVMEQF
KNSKTLFSLMQYSNVFRTHFTFNNFKKNPNPRFLVNPILQLGGTTHTATGIRKVVRELFH
SSYGARKNALKILVVITDGEKYGDPLNYEDVIPEADREGVIRYVIGVGVAFFSEKKLEEL
NIIASKPSSEHVFRVDNFEALKTIQNQLQEKIFAIEGTQTGSSSSFEYEMSQEGFSAAIT
SNGPLMGAVGSFDWAGGAFLSTSENKATFINTTRVDSDMNDAYLGYAAEVILRNRVQSLV
LGAPRYQHTGLVVMFKQDVGTWKTHASVQGSQIGSYFGASLCSVDVNRDSNTDLVLIGTP
HYYEQTRGGQVSVCPLPQGRAKWRCEAVLRGEQGHPWGRFGAALTVLGDMNGDKLTDVAI
GAPGEQENRGAVYLFHGTSGLGISPSHSQRVEGSQLSPRLQYFGQSLSGGQDMTMDGLVD
LAVGAQEHMLLLRSQPVLKVDVAMEFTPREVARNAFECREQVLKNQNAGEVRVCFRVRKI
TRDRLGEGQIQSIITYDLALDSGRPNPRAIFDETKNSTHRQTRTLAMTANCGTLKLLLPD
CVEDSVTPIILRLNFSLVGRPAPSFGNLRPVLAVDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMNLDTLVVGGPRDLNVTVTVRNQGEDSYRTQVTFFYPSGLSYRRVSGAQNQRSQ
RSWRLVCESGPSPEEPGSLKSSSCNINHPIFPDNSEVTFNITFDVDSAASFGNKLLLKAN
VTSENNMPKTNKSEFQLELPVKYTVYMVVTSLEHSTKYLNFTASEKTSLIMEHQYQFNNL
GQRSPSISVVFLVPVLLNKVTVLDNVQVNFSQNIYNSCYTEERLPPHTDFLAEIKKTSVL
NCSIAVCRRIQCDIPSFSTQEEFTVTLKGNLSFDWYIKTANNYLLVVSTAEILFNNSVFA
LLPGQQAFVRAQTETKVEQYEIHDPVPLIVGSSVGGLLLLALITAGLYKLGFFKRQYKDM
MSETAPQADVPQ
Download sequence
Identical sequences G3TBW6
ENSLAFP00000011504 ENSLAFP00000011504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]