SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011524 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011524
Domain Number 1 Region: 37-111
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 5.1e-21
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0019
Further Details:      
 
Domain Number 2 Region: 124-205
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 0.00000222
Family Elongation factor TFIIS domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011524   Gene: ENSLAFG00000013768   Transcript: ENSLAFT00000013766
Sequence length 208
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_17:42516459:42580632:-1 gene:ENSLAFG00000013768 transcript:ENSLAFT00000013766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKFVVRTPRVQNSPQKKDPAAKMYKQATIESLKRVVVVEDIKRWKTILELPDQTKENLV
EALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEVACLAREVYTEWRTFMEKHLHRPSI
EVRSDPKTETFRKNAQKLLSEALELKMDHLLVENIEREAFHLCSRLINRPYRRTVRALVF
TLKHQAEIRAQVKNGLLPVSTFVKTHKK
Download sequence
Identical sequences G3TBY1
ENSLAFP00000011524 XP_003411112.1.64505 XP_010589547.1.64505 ENSLAFP00000011524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]