SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011656 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011656
Domain Number 1 Region: 230-474
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-71
Family Nuclear receptor ligand-binding domain 0.000000000276
Further Details:      
 
Domain Number 2 Region: 120-209
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.18e-28
Family Nuclear receptor 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011656   Gene: ENSLAFG00000013921   Transcript: ENSLAFT00000013922
Sequence length 476
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_36:15440487:15490965:1 gene:ENSLAFG00000013921 transcript:ENSLAFT00000013922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYCMQEMYEVHPAAGSNCFMQSTDYYACLEDSPAFSGCDAQAMPSNNIYMEQAWAVNQP
YTCSYPGNMFKSKDSDLDMALSQYSQPEYFTEEKPTFAQAPSPSYSPKKGYIPSYLDKDE
LCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECR
FKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSMGQKPEPTDEEWELIKTV
TEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVD
FAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGG
LGVVSDAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEH
YINYRKHHVTHFWPKLLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Download sequence
Identical sequences G3TC97
ENSLAFP00000019355 XP_010593854.1.64505 ENSLAFP00000011656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]