SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011747 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011747
Domain Number 1 Region: 1322-1484
Classification Level Classification E-value
Superfamily PH domain-like 2.29e-70
Family Pleckstrin-homology domain (PH domain) 0.00000413
Further Details:      
 
Domain Number 2 Region: 1112-1325
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.26e-52
Family DBL homology domain (DH-domain) 0.0000000949
Further Details:      
 
Domain Number 3 Region: 506-621
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-19
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 4 Region: 887-996
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000493
Family PDZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011747   Gene: ENSLAFG00000014023   Transcript: ENSLAFT00000014027
Sequence length 1723
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_0:2376779:2516282:-1 gene:ENSLAFG00000014023 transcript:ENSLAFT00000014027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTLQGSKNYSNTVTGAKQKPCSLKIRSIHAKDEKSLHGWGHGSSGASYKSRSL
ARSCLSHFKSNQPYASRLSGPTCKVSKGTSYSKQRTNASGNDSQGNNAAFSPENGFHYVG
HQPADNHIASRDCNGHLLNCYGKNESVASTPPGEDRKSPKVLIKTLGKLDGCLRVEFHNG
ANHSKVPAEDSRGPVQLLRYSPTLESDTSQVPAARRNSSSEYPSSHRLSSTDSRLRSSKG
SSLSSESSWYDYPWGNAGEMSELEGSFLAPSTPDPSLHASFPPSDAKKPFSQSASLCSLR
ELYKDTALGGLPPTGIRLSDEYIGTHAGLSNRVSFASDIDVPSRVEHRDPVQYSFTLPCR
KPKALTEDTSKKDTLKSRMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNVDTQ
GPSQLSAFLWSGGSGQVLPQRSESTNAIGSDSLRQNIYENFMRELEMSRTNTENIETSTE
TAESSSESLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWRQYWVT
LKGCTLLFYETYGKNSSDQSSGPRYALLAEDSMVQSVPEHPKKENVFCLSNSFGDVYLFQ
ATSQTDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTKNLLQKIDMDSKMKKMAELQL
SVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAATSRPSK
LALGRLGVLSVSSFHALICSRDDSALRKRTLSLTQRGRNKKGIFSSLKGLDTLARKGKEK
RPSITQIFDSSGGHGFSGTQLPQNSNNSSEVDELLPIYGSTADGVRRDSTWETQAYVHFQ
DNQGVTVMIKPEHRVEDILTLACKMRQLEPSHYGLRLRKLVDENSEWYSPTLHEYMQDQA
YEEIEIFPLNVRAVQLAKTGSVPDFGFAVTAQVDEHQHLSRIFISDVLPDGLAYGEGLRK
GNEIVTLNGEAVADLNLKQMEALFSEKSVGLTLVARPLDAKRTLGTSWSDSDLFSTDQKR
LLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRSQTDGTLDQVSHREKMEQTFRS
AEQIAALCRGFTDTQTGDMEAPRESRDAPPRPLARHLSDADRLRKVIQELVDTEKSYVKD
LSCLFELYLEPLQSETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETP
SQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDQAFKAFLDARNPTKQH
SSTLESYLIKPVQRVLKYPLLLKELVSLTDHESEEHYHLTEALKAMEKVASHINEMQKIY
EDYGTVFDQLVAEQSGTEKEVTELSMGELLMHSTVSWLNPFLSLGKARKDLELTVFVFKR
AVILVYKENCKLKKKLPSNSRPAHGSADLDPFKFRWLIPLSALQVRLGNTAGTENNSLWE
LIHTKSEVEGRPETTFQLCCSDCESKTNIVKVIRSILRENFRRHIKCDLPLEKTCKDRLV
PLKNRVPVSAKLASSRSLKVLRNSSSSEGMGEPSKGTSLDSDDGSLGSSTQSSGCHTAES
RQDSKSASPVKCPPASLSEFSDSLIKESDILSDEEDDYQPALKRGSPTKDIEIQFQRLRI
SEEPDARPAGQPPGTQAREGQQGGEHPKLIRGHFCPIKRKANSTKRDRGTLLKSQVRHQS
LDSQSENAHIDINSVLQREFSVQSLTSVVNEECFYEAEGHGKS
Download sequence
Identical sequences G3TCF9
ENSLAFP00000028010 ENSLAFP00000011747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]