SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011788 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011788
Domain Number 1 Region: 263-611
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-83
Family p120GAP domain-like 0.0000355
Further Details:      
 
Domain Number 2 Region: 568-710
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-34
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 3 Region: 123-240
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.65e-28
Family Synaptotagmin-like (S variant) 0.0055
Further Details:      
 
Domain Number 4 Region: 6-127
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.09e-27
Family PLC-like (P variant) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011788   Gene: ENSLAFG00000014078   Transcript: ENSLAFT00000014078
Sequence length 803
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_70:10511004:10538544:1 gene:ENSLAFG00000014078 transcript:ENSLAFT00000014078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSSSLNVRVVEGRELPAKDVSGSSDPYCIVKVDDEVVARTATIWRSLNPFWGEEYTVH
LPLDFHHLAFYVLDEDTVGHDDIIGKISLSREAITADPRGIDSWINLSRVDPDAEVQGEI
RLSVQLLEDVKGRCLHCHVLQARDLAPRDITGTSDPFARVFWGSQSLDTSTIKKTRFPYW
DEVLKLQELPGAPSPLRVELWDWDMVGKNDFLGMVEFPPQVLQQNPPNGWFRLLPFPRAE
EDVGGLLGALRLKVRLTEDRVLPSPYYQPLVEMLMESVLRPAEEDAASPLAILEELTLGD
CRQDLATKLVKLFLGRGLAGPFLDYLTRREVARTTDPNTLFRSNSLASKSMEQFMKLVGM
PYLHEVLKPVVNRIFEEKKYMELDPCKMELGRTRRISFKGTSSEEHVRETSLGLLTGYLG
PIMDAIVGSVERCPPAMRLAFKQLRRRVEEHFPQAEHEQDLKYLAISGFLFLRFFAPAIL
TPKLFDLRDQHADPQTSRSLVLLAKAVQSIGNLGQQLGQGKELWMAPLHPFLLQSILGVR
DFLDQLVDVEGEGEAGGSARALVPPSVTIREGYLLKRKEEPASLATRFAFKKRYFWLSGE
TLSYSKTPEWQKRSSIPVSHIRAVERVDESAFQLPQVMQVVTQDGAGPLHTTYLQCKNVS
ELNQWLSALRKASAHNPDKLAACHPGAFRSARWTCCLQAERSAAGCSRTHSAVTLGDWSD
PLDPDAETQTVYRQLLLGRDQLRMKFLEDSNMDTTLGADTGKGPSVKGGDCPDILAQQRM
AAAHLLDVLEDLDRAHEEFQQQE
Download sequence
Identical sequences G3TCJ4
ENSLAFP00000011788 ENSLAFP00000011788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]