SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011973 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011973
Domain Number 1 Region: 18-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9e-67
Family BAR domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 479-633
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-27
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 3 Region: 278-373
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-22
Family Pleckstrin-homology domain (PH domain) 0.00000218
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000011973
Domain Number - Region: 620-670
Classification Level Classification E-value
Superfamily Gam-like 0.034
Family Gam-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011973   Gene: ENSLAFG00000014294   Transcript: ENSLAFT00000014297
Sequence length 708
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_12:9935259:9969764:-1 gene:ENSLAFG00000014294 transcript:ENSLAFT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNSLDKYKEESKTNPKVQTRSLLGVFEEDAAAISNYMNQLYQAMRRIYDAQNELSAATHL
TSKLLKEYEKQRFPLGGDDEVMSSTLQQFSKVIDELSSCHAVLSTQFADAMMFPISQFKE
RDLKEILTLKEVFQIASNDHDAAINRYSRLSKKRENDKVKYELTEDVYTSRKKQHQTMMH
YFCALNTLQYKKKIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLTNIGTSVQNVRREM
NSDVETMQQTIGDLEAASDPLYTPDPDPTTFPVNRNLTRKAGYLNARNKTGLVSSTWDRQ
FYFTQGGNLMTQARGDVAGGLAMDIDNCSVMAVDCEDRRYCFQITSFDGKKSSILQAESK
KDHEEWICTINNISKQIYLSENPEEIAARVNQSALEAVTPSPSFQQRHENLRPAGQSRPP
AVRTSSSGSLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKASGQGGRRTNP
FGESGGGTKSETEDSILHQLFIVRFLGSVEVKSDDNPDVVYETMRQILAARAIHNIFRMT
ESHLLVTCDCLKLIDPQTQVTRLTFPLPSVVLYATHQENKRLFGFVLRTSGGRSESNLSS
ICYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELSKQKQIEK
DLEEQSRLIAASSRPNQASNEGQFVVLSSSQSEESDLGEEGKKRESEA
Download sequence
Identical sequences G3TCZ2
ENSLAFP00000011973 ENSLAFP00000011973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]