SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000011985 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000011985
Domain Number 1 Region: 42-189
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-39
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000011985   Gene: ENSLAFG00000014304   Transcript: ENSLAFT00000014310
Sequence length 1201
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:9073746:9168572:1 gene:ENSLAFG00000014304 transcript:ENSLAFT00000014310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNERKVTCKHPVTGQPSQDNCIFVVNEQTITTMTSEEKKERPISMINEASNYSMTSDYAV
HPVSPVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQDSTGMKLWKKRWFVLSD
LCLFYYRDEKEEGILGSILLPSFQIAMLTTEDHINRKYAFKAAHPNMRTYYFCTDTGKEM
ELWMKAMLDAALVQTEPVRSTYHFNMDKVTSENVPTKEMNNIPNHRVLIKPEVQNNHRNK
EISKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLPSEYDSGSACPAQTGHYRPGNV
NSSENKTANISLADVRGGSHPNTGPVHTDADRVIQRTNSMQQLEQWIKIQKGRGHEEETR
GVISYQTLPRNMPSHRAQIVARYPEGYRTLPRNSKTRPESICSVTPSTHDKTVGPGAEEK
RRSMRDDTMWQLYEWQQRQFYNKQSTLPRHGTLSSPKTMVNISDQTMHSIPTSPSHGSIA
AYQGYSPQRTYRSEVSSPTQRVDVTIDRRHRAHHPKHVYVPDRRSMPASLTLQPVGSQSL
QGKTPEELTLLLIKLRRQQAELSSIREHTLAQLMQLKLEAHSPKNEILSHHLQRNTIYLD
HQMKENEPIITMVHTMIENSALRPQLYQQFLRQKNQISLYCLSQEECRGTLYKYRPEEAD
IDAKLSRLCEQDKVVHALEEKLHQLHKEKYTLEQALLSASQEIEMNADDPAAVQTVVVQR
DDLQNGLLSTCRELSRATAELERAWREYDKLEYDVTVTRNQMEEQLDRLGEVQTESAGIQ
RAQIQKELWRIQDVMEGLSKHKQQRGTTEIGMIGSKPFSTVKYKNEEEEVVPPRPPLPRS
YDFTEQPPIIPPLPSDSSSLLCYSRGPVHLPEEKKIYQVQGYPRNGSHCGPDYRLYKSEP
ELTTVAEVDESNGEEKSEPVSEIESSVVKGSHFPVGVVPPRTKSPTPESSTIASYVTLRK
TKKMMDLRTERPRSAVEQLCLAESARPRMTVEEQMERIRRHQQACLREKKKGLSVIGASD
HPSNLRDNPFRITQNRRRDDLLSSNIKEPDTVIRENDVKPNHETPAAEIVRLKEAEPQNT
DISKEVRKTETLFKPEPNGVSSEEAMDEERNKEKMPEDISYSPQDATSVTNPKPEDHPEE
NTKDNVHEQEETVISYELTPEASTGDQTMAVKSLSQSPESSTSPVPTTQPQLVEGSHFMC
V
Download sequence
Identical sequences G3TD03
ENSLAFP00000011985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]