SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012095 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012095
Domain Number 1 Region: 552-771,799-900
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.18e-64
Family Pancreatic carboxypeptidases 0.00000591
Further Details:      
 
Domain Number 2 Region: 377-533
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.32e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00014
Further Details:      
 
Domain Number 3 Region: 900-992
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.89e-21
Family Carboxypeptidase regulatory domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012095   Gene: ENSLAFG00000014436   Transcript: ENSLAFT00000014439
Sequence length 1114
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_63:11882143:11891727:1 gene:ENSLAFG00000014436 transcript:ENSLAFT00000014439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALHGASLLGCLLALLALCPGGRPQTVLTDDEIEEFLEGFLSELEPEPREKDVEPPPPP
ESTPRVRKAQAGGKKAARPGAAGEAPLEKPKDKGKKGKKDKGPKPTKLPSDGSPRPPKKP
KEKPPKTKKPKEKPPKATKKPKEKPPKATKKPKEKPPKATKRPVAGKRSPTPTPPEILEW
PPPLPSSPGLRELPQEGGGALPNPWQGRGGEETGLLGSCERFPPELEEEVPTLDYNDQIE
REDYEDFEYIRRQKKPRPPPSRRRPQRPKGPEEKPEPPRLVQPLEPLQPPPSPDYGDGYV
IPDYDDMDYYFRRPHPRKPDAKLDTDEEKETLKKPKKEGSSPKEEETDDKWAVEKGKDKG
PRKGEEEEWAPVEKIKCPPVGMESHRIEDNQIRASSMLRHGLGAQRGRLNMQAGPNEDDY
YDGAWCAEDDGRTQWIEVDSRRTTRFTGVITQGRDSSIHDDFVTTFFVGFSNDSQTWMMY
SNGYEEMTFHGNVDKDTPVLSEFPEPVVARFIRIYPLTWNGSLCLRLEVLGCPLAPVYSY
YVQNEVVATDNLDFRHHNYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIYAMEISDNP
GEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYVCREYRDGNPRVRSLVHDTRIHLVPSL
NPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPYRVPNNNLP
IPDRYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARPPSQEQLLAAA
MAAARGEEEEDEASEAQETPDHAIFRWLAISFASTHLTMTEPYRGGCQAQDYTSGRGIVN
GAKWNPRSGTINDFSYLHTNCLELSIYLGCDKFPHESELPREWENNKEALLTFMEQVHRG
IKGVVTDEQGIPIANATISVSGINHGVKTAQGGDYWRILNPGEYRVTAHAEGYTPSAKTC
NVDYDIGATQCNFVLSRSNWKRIREIMAMNGNRPIPRIDPSRPMTPQQRMMQRRRLQYRL
RMREQMRLRRLNATATAAATAGPAPTTTLPPTSTLGPWSTLSPTTASWEELETETYTEVV
TELGTEFTLEEELATGPEFPFTTAETYTVNFGDF
Download sequence
Identical sequences G3TD88
ENSLAFP00000012095 ENSLAFP00000012095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]