SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012165 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012165
Domain Number 1 Region: 11-95
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-23
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 123-197
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000214
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012165   Gene: ENSLAFG00000014518   Transcript: ENSLAFT00000014518
Sequence length 200
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_70:338929:359931:-1 gene:ENSLAFG00000014518 transcript:ENSLAFT00000014518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYPSPPMGSVSAPNLPTAEENLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSA
RNKDGRVGMIPVPYVEKLVRSSLHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSTTP
GAAINPLPSTQNGPVFAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRK
GLFPFTHVKIIDPQNPDENE
Download sequence
Identical sequences G3TDE6
ENSLAFP00000012165 ENSLAFP00000012165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]