SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012495 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012495
Domain Number 1 Region: 286-452,553-806
Classification Level Classification E-value
Superfamily Ras GEF 5.1e-107
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 460-562
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-33
Family Ras-binding domain, RBD 0.0000116
Further Details:      
 
Domain Number 3 Region: 24-146
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.03e-28
Family DEP domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012495   Gene: ENSLAFG00000014919   Transcript: ENSLAFT00000014920
Sequence length 807
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_5:36306537:36526204:1 gene:ENSLAFG00000014919 transcript:ENSLAFT00000014920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLSRRISNPYLDHTPSQIYGESSSCAGKALRNIIIVQAADLIKDRVNLKGFYRRSCVGSE
LVDWLLEHCPFVQCRSMAVGVWQLLLDMGIMLSVDRHLHFQDTYVFYQFSSDECSCLYCE
FEREEEWQNGVKLLLHLVPLIPARSGICELSHQKIEDAEETSDEILARLTSAVQRELAAV
IALKARKSAIEQDEENSDKHIAVPEAEGVPQSQAGVMCKLQERDDIGRIELVQKLARENC
QLLQTDKKELEKSEHQDDEVTTVQVKEQDQNVLVLKKVPGGGPAPTSGSTENDWRYVVVS
GTPEKILEHLLNDLHLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALLRHYSAKKYQGK
EENSDVPCRKRKVLHLVSQWIALYKDWLHEDEHSKMFLKTIYRNVLDDVYEYPILEKELK
EFQKILGMHRRHTVDEYSPQRKNKALFHQFSLKENWLQHRGTVTETEEIFCHVYITEHSY
VSVKAKVSTTAQEVLKIVAEKIQHAEEDLALVAVTFSGDKHELQPNDFAISKSLEASSRI
YVYRKDLADTLNPFAESEESQQRSMRILGMNTWDLALELMNFDWSLFNSIHEQELIYFTF
SRQGSGEHTVNLSLLLQRCNEVQLWVATEILLCSQLGKRVQLVKKFIKIAAHCKAQRNLN
SFFAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKI
PFMPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRTLRHCRTNQFGGDVSPKEHQEL
KSYVNHLYVIDSQQALFELSHRIEPRA
Download sequence
Identical sequences G3TE48
ENSLAFP00000012495 ENSLAFP00000012495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]