SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012500 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012500
Domain Number 1 Region: 4-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.15e-63
Family BAR domain 0.002
Further Details:      
 
Domain Number 2 Region: 408-522
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00021
Further Details:      
 
Domain Number 3 Region: 261-362
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-27
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 586-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.71e-23
Family Ankyrin repeat 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012500   Gene: ENSLAFG00000014924   Transcript: ENSLAFT00000014926
Sequence length 740
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_47:11342308:11356484:1 gene:ENSLAFG00000014924 transcript:ENSLAFT00000014926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTCLLESGRHYLAAGRAFI
VGICDLGRLGPPEPMMAECLEKFTESLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRAF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYTLQINVI
EDKRKFDIMEFVLRLVEAQALHFQQGHEELSRLGQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLKEGPSGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVEDLRLCTVKLCPDSERRFCFEVVSPSKSCLLQADSERLLQLWVSAVQSSIA
TAFSQARLDDDPRAPGQASGHLAIGSAATLGCGPMARSRESGGVGHVAAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVV
INQIYEARVDAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEVRGRRGGRGSPRGQP
PVPPKPSIRPRPGSINRKPEPPSDDLGSLHSGALLFRAAGHPPSLPTMADALAHGADVNW
VNGSQENATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADMGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
Download sequence
Identical sequences G3TE52
XP_003416939.1.64505 ENSLAFP00000012500 ENSLAFP00000012500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]