SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012586 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012586
Domain Number 1 Region: 399-593
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-65
Family Nuclear receptor ligand-binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 112-201
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-29
Family Nuclear receptor 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012586   Gene: ENSLAFG00000015034   Transcript: ENSLAFT00000015034
Sequence length 596
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_31:22139353:22146057:-1 gene:ENSLAFG00000015034 transcript:ENSLAFT00000015034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGNIPPSLSDYNGSPPGGLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGD
VASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKNENCSIVRINRNRCQQCRFKKCLSVG
MSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPMGPSPPPA
PTPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIFTYAHDKLGTTPGNFNAN
HASGSPPATTPHRWESQGCPPVPNDNNAVAAQRHNEALNSLRQAPSSYPPSWASGPAHHS
CHQPNSNGHRLCPTHMYSTSEGEASANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWE
DFSMSFTPAVREVVEFAKHIPGFCDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMF
LSRTTYSLQELSAMGMGDLLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMENSA
SVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPLRTLNNMHSEKLLSFRVDAQ
Download sequence
Identical sequences G3TEC6
ENSLAFP00000012586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]