SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012621 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012621
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-41
Family Phosphotyrosine-binding domain (PTB) 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012621   Gene: ENSLAFG00000015074   Transcript: ENSLAFT00000015071
Sequence length 508
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:59943240:59948943:1 gene:ENSLAFG00000015074 transcript:ENSLAFT00000015071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSCCSCPDKDTVPDNHRNKFKVINVDDDGNELGSGIMELTDTELILYTRKRDSVKWHYL
CLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSINVVEEPVVER
NNHQTELEVPRTPRTPTTPGFAAQNLPNGYPRYPSFGDGSSHPSSRHPSVGSARLPSVGE
ESTHPLLVAEEQVHTYVNTTGVQEERKNRTSVHIPLEARASNVESNMPKEEPSSIEDRDP
QILLEPEGVKFVLGPTPVQKQLMEKEKLEQLGRDQVSGSGANNTEWDTGYDSDERRDAPT
VNKLVYENINGLSIPSASGVRRGRLTSTSTSETQNINNSAQRRTALLNYENLPSLPPVWE
ARKLSRDEDDNLGPKTPSLNGYHNNLDPMHNYVNTENVSVPASAHKIEYSRRRDCTPTVF
NFDIRRPSLEHRQLNYIQVDLEGGSDSDNPQTPKTPTTPLPQTPTRRTELYAVIDIERTA
AMSNLQKALPRDDGTSRKTRHNSTDLPM
Download sequence
Identical sequences G3TEF0
ENSLAFP00000012621 ENSLAFP00000012621 XP_010597078.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]