SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012676 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012676
Domain Number 1 Region: 314-413
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.68e-31
Family Ras-binding domain, RBD 0.0036
Further Details:      
 
Domain Number 2 Region: 446-557
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-16
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012676   Gene: ENSLAFG00000015135   Transcript: ENSLAFT00000015138
Sequence length 646
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_3:23406128:23453224:1 gene:ENSLAFG00000015135 transcript:ENSLAFT00000015138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDSDKPVEPVKRSPLRQET
NMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIGSGNSKRQITETKASQK
LPASRHTSKHGTLKGLSSSSNRISKPSHANYSLDDITAQLEQASLSMDEAAQQSALEDTK
PLVTNQHRRTASAGTVSDAEVRSISNSSRSSITSAASSMDSLDIDKVARPQELDLTHQGQ
PITEHAISLRCPSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTKEEQA
AKLKAEKIRVALEKIKEAQVKKLVIRVHKADDSSKTMMVDERQTVRQVLDNLMDKSHCGY
SSDWSLVETISELQMERIFEDHENLVENLLNWTRDSQNKLIFMERIEKYALFKNPQNYLL
GKKETAEMADRNKEVLLEECFGGSSVTVPEIEGVLWLKDDGKKSWKKRYFLLRASGIYYV
PKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPTDYCLVLKHPQIQKKSQYIKYLCCD
DVRTLHQWVNGIRIAKYGKQLYMNYQEAMKRTESTYDWTSLSSSSIKSGSSSSSIPESQS
NHSNQSDSGVSDTQPAGHVRSQSIVSSIFSEAWKRGTQLEESSKVT
Download sequence
Identical sequences G3TEJ6
ENSLAFP00000012676 ENSLAFP00000012676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]