SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012705 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012705
Domain Number 1 Region: 478-719
Classification Level Classification E-value
Superfamily VPS9 domain 6.54e-55
Family VPS9 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 42-163
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000000404
Family SH2 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 736-817
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000173
Family Ras-binding domain, RBD 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012705   Gene: ENSLAFG00000015169   Transcript: ENSLAFT00000015174
Sequence length 841
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:7683575:7724460:-1 gene:ENSLAFG00000015169 transcript:ENSLAFT00000015174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMVRHKGDGYSEEEEDVKACPRDSGYDSLSSRLSILDRLLHTHPIWLQLSLSEEEAAQVL
RSQPPGIFLVRKSIKMQKKVLALRLPCEFGVPLKEFAIKESTYTFSLEGSGISFADLFRL
IAFYCISRDVLPFTLKLPYAISTAKTEARLEELAQLGLNFWSSPADSQPPNPPPPRRPLS
SDTAGPASSQLCLINGVHSIKTRTPSELECSQSNGALCFINPLFLKVHSQDLSGSLPRSS
TRTPSVNGTTRPRSPPPRPPPPTINSLHTSSQLSRSETQASMPETANHSKHGNVAVPGTK
PTPVPPPRLKKQASFLEAESSAKTLTGRPGPGLQPELGTAGGPGGTPPSEAPGDCTRAQP
PGSESRPPWNGGRQRLSDMSISTSSSDSLDFDRSMPLFGYEADTNSSLEDYDGESDQETM
PPPIKSKKRSSSFVLPKIVKSQLRKMSGVFSSFMTPEKRMVRRIAELSRDKRTYFGCLVQ
DYVSFLQENKECHVSSTDLLQTIRQFMTQVKNYLSQSSELDPPIESLIPEDQIDVVLEKA
MHKCILKPLKGHVEAMLKDFHVADGSWRQLKDNLQLVRQRNPQELGVFAPTPDFVDVEKI
KVKFMTMQKMYSPEKKVMLLLRVCKLIYTVMGNNSGRMYGADDFLPVLTYVIAQCDMLEL
DTEIEYMMELLDPSLLHGEGGYYLTSAYGALSLIKNFQEEQAAQLLSSETRDTLRQWHKR
RTTNRTIPSVDDFQNYLRVAFQEVNSGCTGKTLLVRPYVTTEDVCQLCAEKFKVGDPEEY
SLFLFVDETWQQLAEDTYPQKIKAELHSRPQPHVFHFVYKRIKNDPYGVIFQNSEEDLAT
S
Download sequence
Identical sequences G3TEM0
ENSLAFP00000012705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]