SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012877 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000012877
Domain Number 1 Region: 1029-1196
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000482
Further Details:      
 
Domain Number 2 Region: 469-671
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-45
Family DBL homology domain (DH-domain) 0.00053
Further Details:      
 
Domain Number 3 Region: 1-67
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 6.15e-35
Family Bcr-Abl oncoprotein oligomerization domain 0.0000193
Further Details:      
 
Domain Number 4 Region: 685-754,812-847
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-16
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 5 Region: 889-1015
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000000000789
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012877   Gene: ENSLAFG00000015367   Transcript: ENSLAFT00000015368
Sequence length 1250
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_68:1558031:1702515:-1 gene:ENSLAFG00000015367 transcript:ENSLAFT00000015368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDPVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQ
TLLAKEKKSYDRQRWGFRRAAQPPDGAAEPRAPRPVPAESAVDEAEPRPDGEGSPAKARP
AAARRPVSEDRAPPPSVAALRSNFERVRKGAGPAGSDAEKPFYVNVEFHHERGLVKVNDK
EVSERISVLGSQAMLLERKKSVVGGGDAPRPPHRARVSESGCGLDGDYEDAELNPRFLKD
NLIQANGSGRPPWPPLEYQPYQSVYVGGLMGEVEGKGQLLRSQSASEPEKRLTWPRRSYS
PRSFEDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQS
FESSSPPTPQCQKRHRQGQVVVSEATIVGVRKTGQIWPSDGDSLHGEPDATFGTPPGYGC
AADRDEEQRRHQDGLPYIDDSPSSSPNLSSKGRGGRDALAAGTSESSELDLEKGLEMRKW
VLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTIQQIETIFFKVPELYEIHKDFY
DGLLPRVQQWGHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISEN
LRARSNKDSKDQTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPPSHPDHPLLQDALRIS
QNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCAKLK
KQSGSKTQHYDCKWYIPLTDLSFQTVDETEAAPNLPLVPDEELDAMKIKISQIKNEIQRE
KRANKGSKAIERLKKKLSEQESLLLLMSPNMAFRVHNRNGKSYTFLISSDYERAEWRENI
REQQKKCFKSFSLTSVELQMLTNSCVKLQTVHNIPLTINKEDDESPGLYGFLNVIVHSAT
GFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCY
NKTKVTKEDGENTDRIMGKGQVQLDPQALQDKDWQRTVITMNGIEVKLSVKFTSREFSLK
RMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQAL
KAAFDANNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKE
SCMLNLLLSLPEANLVTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPSEKESKL
PATPGQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSVLFSTEV
Download sequence
Identical sequences G3TF08
ENSLAFP00000022065 ENSLAFP00000012877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]