SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000012996 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000012996
Domain Number - Region: 581-719
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000249
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000012996   Gene: ENSLAFG00000015508   Transcript: ENSLAFT00000015510
Sequence length 1204
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_19:37407127:37436965:-1 gene:ENSLAFG00000015508 transcript:ENSLAFT00000015510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPPSLDTAIQHALAGLYPPFEATAPTVLGQVFRLLDSNFQGDGLNFLLDFLIPAKRLCE
QVREAACAPYSHHLFLHEGWPLCLRNEVVVHLAPLNPLLLRQGDFYLQVEPQEEQSVCIV
IKCLSLDLRTVDKKPIPESSYPILFTQEWLEAINSDFEGSPLHSCLVASENGISLMPWTK
ITRPEFVDDKPQAVNVLSPLWGSLQLEALNLSSPQELHQARSPGSQEFLAQSLAKGMGRT
NGNKYPGLIKVEQARSGEVAFKIDDVVLEGDYVALLDFSQESSGGSPSREAETSSECSYA
ALEELSQTKETPLSQRKLPPSGANGGSFLEKWTCAKSAGSKEEPCILGLRRKVNHEAPIP
DSERPPQEPYLEVLENPLDCASGLRAGVSEEPAGSRSQGSLGNPENMSQLRPGPRQASSP
RLSPVSAPARETKMEDRTTQGHGRLPKHMTSPSRSASSSGSPTPGPKFSFLKGQRLSPTS
PERVSLQHDQPWKVLCSLYSPKSNRAKPLGKAETTQTKTSCLATDSDPLTGAKGGFPEAS
VRLPERGPTLDEAPLGPEPRIGALSVEICHSRIACLPGPGGGRDRSGRPLLLVSTYEGTW
EAPWCSVSEVTKLLSYLCTVPRSEAKTKGLTVVIDARKQPPHPSLVSALQATQVLVPASI
QALLFLGEKEAAVQLETLPGVQVEVFTSLQALSHHVDPSQLPTALGGPFPYCHSEWVQFF
QKLDTFLADLRQASSLLQASIEEFEKCDAPGGVQEAARCLSKSKELMEAVLRDPGLLGLQ
QKGGATLARLRQQASRLDFNPDVRSHLAEAAALYGLVDEQLHVLVTVSNHLLGKLELRVR
LGRLEASIHQVSDWMEQEGSRYLQALTPKDGSLETVEKTHAEFEEFFLQAAAQYCRGLEL
SKQAAQLGAVAGGAGKAGEAGFPEMAAFATTQRAFQAKLTHFYMAAERQRTDLETLLHLH
RFCKKMTWFHMDCQDLMTQLRLGKAQGASPGDQRRLHRYLQRLASEFPAEKLTAMELQVA
SLSWADLGQDLWEEARGRHEEIWTLLKKALAHCPRPATPTVHSTHPELGGVAAKVQDLSG
DISFRRWQDPPLRDSLGMERLPKSSWPLRATRGRQYRNFQPGLLPQEAGQAVDANECKGP
HEPLDPAPEHSPATPFSRQWLPRQLCLGPLSQVSHQAGGSFSSDGTDSQTSLEDSPQTSP
PASL
Download sequence
Identical sequences G3TFA6
ENSLAFP00000012996 ENSLAFP00000012996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]