SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013031 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013031
Domain Number 1 Region: 200-458
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.8e-74
Family Nuclear receptor ligand-binding domain 0.0000000106
Further Details:      
 
Domain Number 2 Region: 126-212
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-30
Family Nuclear receptor 0.00000657
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013031   Gene: ENSLAFG00000015544   Transcript: ENSLAFT00000015548
Sequence length 459
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_9:52460907:52520241:1 gene:ENSLAFG00000015544 transcript:ENSLAFT00000015548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSLALCSSPRSFPLSFHLLLRLLNRMSTDDRHLGSSCGSFIKTEPSSPSSGIDALSHHS
PSGSSDASGGFGMALGAHANGLDSPPMFAGAGLGGTPCRKNYEDCASGIMEDSAIKCEYM
LNAIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKS
CQACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRLDSESSPYLSLQISPPAKKPLTKIVS
YLLVAEPDKLYAMPPPGMPEGDIKALTTLCDLADRELVVIIGWAKHIPGFSNLSLGDQMS
LLQSAWMEILILGIVYRSLPYDDKLVYAQDYIMDEEHSRLAGLLELYRALLQLVRRYKKL
KVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPRRTGKLLL
TLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences G3TFD3
ENSLAFP00000013031 ENSLAFP00000013031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]