SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013272 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013272
Domain Number 1 Region: 78-356
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-79
Family Nuclear receptor ligand-binding domain 0.00000000122
Further Details:      
 
Domain Number 2 Region: 25-104
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.74e-27
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013272   Gene: ENSLAFG00000015824   Transcript: ENSLAFT00000015826
Sequence length 396
Comment pep:novel supercontig:loxAfr3:scaffold_36:13877320:14034405:-1 gene:ENSLAFG00000015824 transcript:ENSLAFT00000015826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIETQSTSSEELLPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKN
MIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYE
MTAELDDLTETIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKI
VEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHN
AGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEAL
KIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
HEPLTPSSSGNTAEHSPSISSSSAENNGVSQSPRVQ
Download sequence
Identical sequences G3X8H8
ENSLAFP00000013272 ENSLAFP00000013272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]