SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013337 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013337
Domain Number 1 Region: 1014-1348
Classification Level Classification E-value
Superfamily NHL repeat 4.45e-25
Family NHL repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 1250-1463
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 0.00000000602
Family Soluble quinoprotein glucose dehydrogenase 0.036
Further Details:      
 
Domain Number 3 Region: 706-780
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000549
Family Pre-dockerin domain 0.073
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000013337
Domain Number - Region: 515-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000428
Family Integrin beta EGF-like domains 0.052
Further Details:      
 
Domain Number - Region: 449-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000437
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 545-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000465
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 381-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00205
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 582-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00304
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 416-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00381
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 351-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00716
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013337   Gene: ENSLAFG00000015906   Transcript: ENSLAFT00000015902
Sequence length 2548
Comment pep:novel supercontig:loxAfr3:scaffold_37:20312274:20556687:1 gene:ENSLAFG00000015906 transcript:ENSLAFT00000015902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPANNQGQSTLQPLPPSQKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTP
ESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNT
LSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFEN
GKVNADTMPTNTVSLPSGDNGKLSGFTQENNTIDSGELDIGRRAIQEVPPGIFWRSQLFI
DQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLLESERAGR
QARSVSLHEAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIVIESVVECPRNCHGNGECVS
GTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCQCFSGWKGTECDVPTTQCIDPQCGGR
GICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCNPGWGGNNCELLKTMCPD
QCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGGTCRCEEGWTGPACNQR
ACHPRCAEHGTCKDGTCECSQGWNGEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQNGWH
CVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQSSCQNQPYCRGLPDPQDV
ISQSLQSPSQQAAKPFYDRISFLIGSDSTHVIPGESPFNKSLASVIRGQVLTADGTPLIG
VNVSFLHYPEYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWSVFYVMDT
LVMKKEENDIPSCDLSGFVRPNPVIVSSPLSTFFRSSPEDSPIIPETQVDPYHSTLWLPQ
IHVLPSYKTHSPPSNYSQSLKSTLNFRCVPSWGKIPLHLSICETLIANYLFPNPSRPHSF
AAWAWLYAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGCELDASNMGGWTLDK
HHVLDVQNGILYKGNGENQFISQQPPVVSSVMGNGRRRSISCPSCNGQADGNKLLAPVAL
ACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSSNPAHRYYLATDPVTGDLYVS
DTNTRRIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFDEARCGDGGKAVEATLMSPKGMAV
DKNGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAIN
PMDNSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYSAGKHAVQTTLESATAIAVS
YSGVLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDANCDCYQSGDGYAKDAKL
SAPSSLAASPDGTLYVADLGNIRIRAVSENKPLLNSMNCYEVASPTDQELYIFDINGTHQ
YTVSLVTGEYLYNFSYSNDNDITAVTDSSGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGT
NGCLKSMTAQGLELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTSL
HGDMDKAITVDVESSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRIIYASG
LDSHYQTEPHVLAGTANPTVAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNG
RNLLSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIAS
IQRGTTSEKVDYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLSA
ITMPSVARHTMQTIRSIGYYRNIYNPPESNASIITDYNEEGLLLQTAFLGTSRRVLFKYR
RQTRLSEILYDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDG
MVNARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIIS
TAVMTYTKHFDAHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYE
YDVDGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSNSARLTPLRYDLRDRITRLGDVQYRL
DEDGFLRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSTKTSLGQHLQFFYA
DLTYPTRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGL
MLKQIQYTAYGEIYFDSNIDFQLVIGFHGGLYDPLTKLIHFGERDYDILAGRWTTPDIEI
WKRIGKDPAPFNLYMFRNNNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDL
TEPSYELVKSQQWDDVPPIFGVQQQVARQAKAFLSLGKMAEVQVSRRKAGGEQSWLWFAT
VKSLIGKGVMLAVSQGRVQTNVLNIANEDCIKVAAVLNNAFYLENLHFTIEGKDTHYFIK
TTTPESDLGTLRLTSGRKALENGINVTVSQSTTVVNGRTRRFADVEMQFGALALHVRYGM
TLDEEKARILEQARQRALARAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYY
VLSVEQYPELADSANNIQFLRQSEIGKR
Download sequence
Identical sequences G3TFY2
ENSLAFP00000013337 ENSLAFP00000013337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]