SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013347 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000013347
Domain Number - Region: 1-49
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000142
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013347   Gene: ENSLAFG00000015909   Transcript: ENSLAFT00000015914
Sequence length 1592
Comment pep:novel supercontig:loxAfr3:scaffold_77:7102149:7182388:1 gene:ENSLAFG00000015909 transcript:ENSLAFT00000015914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYVFLVNTGTTLTFDTELTVQTVADLKHAIQSKYKIAIQHQVLVVNGGECMAADRRVC
TYSAGTDTNPIFLFNKEMILCDRPPAIPKTTFSTENDMEIKVEESLMMPAVFHTVASRTQ
LAVEMYEVAKKLCSFCEGLVHDEHLQHQGWAAIMANLEDCSNSYQKLLFKFESIYSNYLQ
SIEDIKLKLTHLGTAVSVMAKIPLLECLTRHSYRECLGRLDSLPEHEGSEKAEMKRSTEP
VLSSETPRTTNRSSLTSFPKSVEDVMPDAADGEGGKEVRESCHTAVQRDGTSVGAKDDDL
PFFNVSLLDWINVQDRPNDVESLVRKCFDSMSRLDPRIIRPFLAECRQTIAKLDNQNMKA
IKGLEDRLYALDQMIASCSRLVNEQKELAQGFLANQMRAENLKDASVLPDLCLSHANQLM
IMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFVMLHADQDGEKLQALLRLVIELLE
RVKIVEALSTVPQMYCLAVVEVVRRKMFIKHYREWAGALVKDGKQLYEAEKSKREFFGKL
FRKSFLRNRLFRGLDSWPSSFCTQKPRKFDCELPDISLKDLQFLQSFCPSEVQPFLRVPL
LCDFEPLHQHVLALHNLVKAAQSLDEMSQTITDLLSEQKTSASQASPQSASSPRTESATG
IAPTTSPSTPPPLTVQGPFCPAVCPLEELSPDSIDAHTFDFETIPHPNTEQTLDQGSLDL
DSLAESPESDFMSAVNEFVIEENSSSPNPVSDPQSPEMMVESLYSSVINAIDSRRMQDTN
VCGKEDSGGHASNVQLEKCRVVAQDSHFSIQTIKEDLCHFRALVQKEQCDFSNSLRGTAV
EIRNIIEKVRCSLEVTLQEKHQRELQTLKNEYEAKLDALIKESEENENKIKKLKGDLVCL
EEVLQNKDNEFALVKHEKEAVICLQNEKDQKLLEMENIMHTQSCEIKELKESREIALGDL
KKLHVENDEKMQLLRAELQYLEQSHLKELEDTLQVRHTQEFEKVMTEHRVSLEKLKEENQ
HRIDQIQESHATIVQEKEQQLQELKLKVSDLSDMRCKLEVELALKEAETDEIKLLLEESK
AQQKETLKSLLEQETEGLRTEISKLNQKIQDNNDNHQVGLAELRTLMTIEKDQCISELIS
RHEEESNMLKAELNEVTSLHHQAFEIEKKLKDQIVELQNKVESELSTLEKQNDKKMIQQE
ERYEAIIHKLEKDKEKLIVSQDHDREQLIQKLNSEKEEAIKAALNEFKLGRDAAEKELLE
KVQYLETQLAKSKMFPPAREESSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRT
SLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEK
KKLEEEVSKLRSSSLLPSPHVAAAPERFGACAPELPGETERSAVETTDEGRLDSAMETSM
MSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQ
VGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPGLDLKPGEGASGASRRPWVLGKVMEK
EYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
Download sequence
Identical sequences G3TFZ0
ENSLAFP00000013347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]