SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013485 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013485
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-60
Family DBL homology domain (DH-domain) 0.0000159
Further Details:      
 
Domain Number 2 Region: 221-362
Classification Level Classification E-value
Superfamily PH domain-like 2.65e-34
Family Pleckstrin-homology domain (PH domain) 0.00067
Further Details:      
 
Domain Number 3 Region: 384-491
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.14e-28
Family DEP domain 0.0029
Further Details:      
 
Domain Number 4 Region: 477-606
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-28
Family DEP domain 0.0012
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000021
Family PDZ domain 0.018
Further Details:      
 
Domain Number 6 Region: 581-673
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000736
Family PDZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013485   Gene: ENSLAFG00000016048   Transcript: ENSLAFT00000016068
Sequence length 1605
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:14487905:14860266:1 gene:ENSLAFG00000016048 transcript:ENSLAFT00000016068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEESRGDGRAESAKNLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASK
VDKNVTEETVKMLFSNIEDILAVHKEFLKAVEECLHPEPNAQQEVGTCFLHFKDKFRIYD
EYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLLL
KELLKRTPRKHSDYTAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEGWEGSNIT
DTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHRRLKNSKAATDGHRYLFRGRI
NTEVMEVENVDDGTADFHSSGHVVVNGWKIHNTAKNKWFVCMAKTPEEKHEWFEAILKER
ERRKGLKLGMEQDTWVMISEQGEKLYQMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL
EIGEIHKPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVIS
KGVRLYCRLHSLFTPVVRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLC
DNGFMHHVLEKSEFKDEPLLFRFFADEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNE
GSYGFGLEDKNKVPIIKLVEKGSNAEMAGMEVGKKIFAINGDLVFMRPFNEVDCFLKSCL
NSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVHAVGRGTVAAAAGLHPGQCII
KVNGINVSKETHASVIAHLTACRKYRRPMKQDSIQWVYDSIESAQEDLQKSNSKLPGDEA
GDAFNCKVEEVIDKFNTMAIIEGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNMVEKMI
EPKGFFSLTAKILEALAKSDDHFVQSCTSLNSLNEVIPADLQSKFSAICSEKIEHVCQRI
SSYKKFSRVLKNRAWPTFKQAKSKISPLHSSDFCPTNCHINVMEVSYPKTSTSLGSAFGV
QLDSRKHNSHDKENKSEQGKLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDLE
TQDIYQKLLGKLQTALKEVEMCVCQIDDLLSSITYSPKLERKTSESMIPTDSDNEKGERN
SKRVCFNVAGDEQEDSGHDTVSNRDSYSDCNSNRNSIASFTSVCSSQCSSYFHSDEMDSG
DELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVMRAFEQTKYLTPARGLEEFQ
QEMEPKLSCPKRLRLHIKQDPWNLPSSVRNLAQNIRKFVEEVKCRVLLALLEYSDSETQL
RRDMVFCQSLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHFQ
SLLSPNLADEQAMLEDTLIALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVYF
SIDSYHFEQLPQRLKNGGGFKIHPVLFAQALESMEGYYYKDNVSVEEFQAQINAASLEKV
RQYNQKLRAFYLDKSNSPPNSTSKAAYVDKLMRPLNALDELYRLIASFVKSKRTAACANT
ACSASGVGLLSVSSELCNRLGACHVIMCNSGVHRCTLSVTLEQAIILARSHGLPPRYIMQ
ATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPVGEE
Download sequence
Identical sequences G3TGA1
ENSLAFP00000013485 ENSLAFP00000013485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]