SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013593 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013593
Domain Number 1 Region: 154-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 40-150
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-30
Family Pleckstrin-homology domain (PH domain) 0.00000635
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000013593
Domain Number - Region: 547-633
Classification Level Classification E-value
Superfamily Tropomyosin 0.0248
Family Tropomyosin 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013593   Gene: ENSLAFG00000016192   Transcript: ENSLAFT00000016193
Sequence length 645
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_27:20273302:20395485:1 gene:ENSLAFG00000016192 transcript:ENSLAFT00000016193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKLPRNWEFNLKSEAGKIARSQSVMTGLPMAAFHASSTPNPLERPIKMGWLKKQRSIV
KNWQQRYFVLRAQYLYYYKDEEDTKSQGFMYLPGSTIKEIATNPEEAGKFVFEVIPASWD
QSRTGQDSYVLMASSQAEMEEWVKFLRRVAGTPSGAVFGQRLDETIAYEQKFGPHLVPIL
VEKCAEFIREHGLNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRDTDVHTVASLLKLYL
RDLPEPVVPWSQYEGFLLCGQLMNADEAKAQQEMMKQLSILPRENYNLLSYICRFLHEIQ
LNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDE
PLSPPAQKNDPKKPPVARSSVGWDATEDTPISRTDSFSNTTSDSDTTSPTGLQPSDGYLD
DSSKLSKEKPGDWKLQSRKRTQTLPNRKSFFTSSLRGSNSSKVEVSKNKLCSPSETKAGE
GHQRTMSQDLPHLSDSQRTSTYDNVPALPASPGNEASSPSSQACDSKRDSPASPNSEAGS
GTKDSGEEELESPQRMVQELRKEIETQKQAYEEQIKNLEKENYDVWAKVVKLNEELEKEK
KKFAALEISLRNVERSREDVERRNKALEEEVKEFVRLLKEPKTDA
Download sequence
Identical sequences G3TGI6
ENSLAFP00000013593 ENSLAFP00000013593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]