SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013626 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013626
Domain Number 1 Region: 137-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-75
Family Nuclear receptor ligand-binding domain 0.00000000287
Further Details:      
 
Domain Number 2 Region: 85-168
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-31
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013626   Gene: ENSLAFG00000016234   Transcript: ENSLAFT00000016236
Sequence length 464
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_31:22312712:22335172:1 gene:ENSLAFG00000016234 transcript:ENSLAFT00000016236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPVSSYSAPSPAT
VETQSSSSEDIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKGACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPERVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQPGGRGRDRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP
Download sequence
Identical sequences G3TGL2
ENSLAFP00000013626 ENSLAFP00000013626 XP_003414758.1.64505 XP_010592726.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]