SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000013931 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000013931
Domain Number 1 Region: 1-246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.31e-74
Family Protein kinases, catalytic subunit 0.000000000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000013931   Gene: ENSLAFG00000016594   Transcript: ENSLAFT00000016594
Sequence length 262
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_457:966:5037:1 gene:ENSLAFG00000016594 transcript:ENSLAFT00000016594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YLVMPFMGTDLGKLMKHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPGNLAVNEDC
ELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWKHYTQTVDIWSVGCIMAEMITGKTL
FKGNDHLDQLKEIMKVTGTPSAEFVQGLQSADAKNYMKGLPELEKKDFASILTNASPLAV
NLLEKMLVLDAEQRVTAAEALAHPYFEALHEAEDEPTPQKYDDSFDDVDRTLDEWKRVTY
KEVLSFKPPRQLGSRASKETAL
Download sequence
Identical sequences G3THA9
ENSLAFP00000013931 ENSLAFP00000013931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]