SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014096 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014096
Domain Number 1 Region: 14-313
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.63e-80
Family Pancreatic carboxypeptidases 0.0000000005
Further Details:      
 
Domain Number 2 Region: 314-414
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 4.32e-22
Family Carboxypeptidase regulatory domain 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014096   Gene: ENSLAFG00000016809   Transcript: ENSLAFT00000016810
Sequence length 443
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_2:59094859:59170293:-1 gene:ENSLAFG00000016809 transcript:ENSLAFT00000016810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFARLWLGLLLPLVAALDFNYHHQEAMEEFLKSVAQNYSSITHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGVPEFKYVANMHGDETVGRELLLHLIEYLVTNDGKDPEITNLINSTRIH
IMPSMNPDGFEAVRKPDCFYSNGRENYNQYDLNRNFPDAFEFNNVSRQPETEAVMKWLKK
ETFVLSANLHGGALVASYPFDNGVPATGTLHSRSLTPDDDVFQYLAHIYASRNPNMKKGD
QCKNNVNFPNGVTNGYSWYPLLGGMQDYNYIWAQCFEITLELSCCKYPREEKLPLFWNDN
KASLIEYIKQVHLGVKGQVFDHNRIPLPNVIVEVQDRSHICPYRTNRFGEYYLLLLPGSY
VINVTVPGHEPHLTTVVIPEKSQNFSALKKDILLPFQGQLDSIPVSDPSCPMSPLYRNLP
SHSAATKPSLFLLLVTVLHIFFK
Download sequence
Identical sequences G3THN0
ENSLAFP00000014096 ENSLAFP00000014096 XP_003405243.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]