SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014189 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014189
Domain Number 1 Region: 363-624
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.23e-55
Family Nuclear receptor ligand-binding domain 0.0000000188
Further Details:      
 
Domain Number 2 Region: 291-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.22e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014189   Gene: ENSLAFG00000016922   Transcript: ENSLAFT00000016926
Sequence length 626
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_6:59408144:59441633:-1 gene:ENSLAFG00000016922 transcript:ENSLAFT00000016926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYGSEYTPEIMNPDYTKLTMDFGSTEITATATTSLPSFST
FMEGYSSSYELKPSCLYQMQPSGPRPLIKMEEGRAHGYHHHHHHHHHHHHHQQQQQQPIH
PSSSPEDEVLPSTSMYFKQSPPSTPSTPSFPPQAGAVWDEALPSAPGCIAPGPAAGPADE
GGCPRWPGARYPALPLQNPSPPHPGPSPCRRPHLGYDSTGARAQPALGAAVAGSQAAALE
GPYGLALAKRAAALAFPPLGLTASAASSSLLGESPGLPSPPNRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC
STDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVL
RLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSAL
SMVTERHGLQEPKRVEELCNKITSSLKDHQSKGQALEPTEPKVLRALVELRKICTLGLQR
IFYLKLEDLVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences G3THV8
ENSLAFP00000014189 ENSLAFP00000014189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]