SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000014835 from Loxodonta africana 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000014835
Domain Number 1 Region: 141-507
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 2.94e-94
Family Phosphonoacetate hydrolase 0.015
Further Details:      
 
Domain Number 2 Region: 584-850
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.77e-34
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 46-92
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000785
Family Somatomedin B domain 0.0015
Further Details:      
 
Domain Number 4 Region: 94-134
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000536
Family Somatomedin B domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000014835   Gene: ENSLAFG00000017681   Transcript: ENSLAFT00000017689
Sequence length 852
Comment pep:known_by_projection supercontig:loxAfr3:scaffold_8:65793075:65878429:-1 gene:ENSLAFG00000017681 transcript:ENSLAFT00000017689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTSLFTFAIGVNICLGYTVNRAKRAEGWDEGPPPVLSDSPYVSTSGSCKGRCYELQELEP
PDCRCDNLCKSYSSCCYDFDEHCLKTARGWECTKDRCGEGRNEENACHCSEDCLAKGDCC
TNYHVVCRGESHWVDDDCEEIKAAECPVGFVRPPLIIFSVDGFRASYMKKGSKVMPNIEK
LRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAIFHLRGREKFN
HRWWGGQPLWITATKQGVKAGTFFWPIVIPHERRILTILQWLTLPDDERPSVYAFYSEQP
DVSGHRHGPFGSEMVNSLRDIDKLVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDRTE
FLNEYLTNVEDIILVPGSLGRIRSRFSNNPKYDPKAILANLTCKKPEQHFKPYMKQHLPK
RLHYANNRRIEDIHLLVDRRWHIARKPVDVYKKPSGKCFFQGDHGFDNKINSMQTVFLGY
GPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNIFRPTMPEEVTRP
NYPGVTYLQSDFDLGCSCDDKVAPKSKLDELNKRLNIKGSTEERHLLYGRPAVLYRTRYD
ILGHTDFESGYSEIFLMPLWTSYTVSKQAEVSVIPEHLTSCVRPDVRVSPSFSQNCLAYK
NDKQMSYGFLFPPYLSSSPEAKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERNGV
NVISGPIFDYDYDGLHDTQDKIKQYVEGSSIPVPTHYYSIVTSCLDFTQPADKCDGPLSV
SSFILPHRPDNEESCNNSEDESKWVEELIKMHTARVRDIEHLTSLDFFRKTSRSYPEILS
LKTYMHTYESEI
Download sequence
Identical sequences G3TJD5
ENSLAFP00000014835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]